(data stored in ACNUC7421 zone)

EMBL: CP001349.PE260

CP001349.PE260       Location/Qualifiers
FT   CDS_pept        297415..298830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0268"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: met:M446_2341 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55312"
FT                   /db_xref="GOA:B8I9Q9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q9"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ACL55312.1"
FT                   /translation="MLHVSTRGAAAKLTFTDALLAGLARDGGLYLPERWPALDPAAIAG
FT                   LAGRPYAAAAKTVLSPLVDGEIPQGDLDRMIEGAYATFRHPAVCPLVQLGDNLFLLELH
FT                   HGPTLAFKDVAMQLLGRLMDHVLKARGSRATIVGATSGDTGSAAVEAFRGLDQVDVFIL
FT                   FPHGRVSEVQRRQMTTVDSANVHAVAVEGTFDDCQAIVKALFQHPRFAEEVRLSGVNSI
FT                   NWARVAAQAVYYFTSAVALGSPHRPVSFSVPTGNFGDILAGWVAKRMGLPVGRLMIATN
FT                   ANDILARTLASGAYEVRGVAPTTSPSMDIQVSSNFERLLFEALDREPEGLNRLMASLKQ
FT                   SGAFSLPPAVLERVRAEFDAAAVQEPEVAAEIRETYRSTGYVLDPHSAIGVRAGRRLLD
FT                   ADPATPVVALATAHAAKFPDAVEAATGQRPALPPHLADLMTRRERFAVLPNDEGAVERF
FT                   IRERARILRGAAA"
     gtgcttcatg tctcgacccg cggcgccgcc gcaaagctga ccttcaccga tgcgctcctc        60
     gccggccttg cccgcgacgg cggcctctac ctccccgagc gctggcccgc cctcgatccg       120
     gcggccatcg cgggccttgc cgggcgtccc tacgcggccg cagccaagac cgtgctgtcg       180
     cccctcgtcg acggcgagat cccgcagggc gacctcgacc ggatgatcga gggggcctat       240
     gccaccttcc ggcacccggc cgtctgcccg ctggtgcaac tcggcgacaa cctcttcctg       300
     ctcgaactcc accacggccc gacgctcgcg ttcaaggacg tggcgatgca gctcctcggg       360
     cggctgatgg atcacgtgct gaaggcccgc ggcagccgcg ccaccatcgt gggtgccacc       420
     tccggcgata cgggcagcgc cgccgtcgag gccttccgcg gcctcgatca ggtcgacgtc       480
     ttcatcctgt tcccgcacgg ccgcgtgtcg gaggtgcagc ggcgccagat gacgacggtg       540
     gattcggcca acgtccacgc cgtcgcggtc gagggcacct tcgacgattg ccaggcgatc       600
     gtgaaggcgc tgttccagca cccgcgcttt gccgaggagg tgcggctgtc gggcgtcaac       660
     tcgatcaact gggcgcgggt cgccgcgcag gccgtctact acttcaccag cgccgtggcg       720
     ctcggctccc cgcatcgccc ggtctccttc tcggtgccga ccggcaattt cggcgacatc       780
     ctggccggtt gggtcgccaa gcggatgggc ctgccggtcg gccggctgat gatcgcgacg       840
     aacgccaacg acatcctggc ccgcacgctg gcgagcggcg cctacgaggt gcgcggcgtt       900
     gcccccacca cctcgccctc gatggacatc caggtctcct cgaacttcga gcgcctgctc       960
     ttcgaggccc tcgaccggga gcccgaaggg ctcaaccgcc tgatggcgag cctcaagcaa      1020
     tcgggcgcct tctcgctccc gcccgcggtg ctggagcggg tgcgggcgga gttcgacgcg      1080
     gcggcggtcc aggagccgga ggtcgcggcc gagatccgcg agacctaccg gagcacgggc      1140
     tatgtgctcg atccgcacag cgccatcggc gtgcgggccg gccgccggct cctcgatgcc      1200
     gatccggcga cgccggtcgt ggcgctcgcg accgcgcatg cggcgaagtt cccggatgcg      1260
     gtcgaggccg cgacggggca gcgccctgcc ctgccgcccc atctcgccga cctgatgacc      1320
     cggcgcgagc gcttcgccgt gctgcccaac gacgagggcg cggtcgagcg cttcatccgc      1380
     gagcgggcgc gcatcctgcg cggagccgcc gcgtga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page