(data stored in ACNUC7421 zone)

EMBL: CP001349.PE261

CP001349.PE261       Location/Qualifiers
FT   CDS_pept        298827..300122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0269"
FT                   /product="peptidase M16 domain protein"
FT                   /EC_number="3.4.24.64"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2340 processing peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55313"
FT                   /db_xref="GOA:B8I9R0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R0"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55313.1"
FT                   /translation="MNEHFATFGASPSLRITRLPNGLTVATEPMPGVATATLGVWVGAG
FT                   SRHERPQEHGLSHLIEHMAFKGTCRRSARAIAEDIENVGGDINAATSAEQTSYTARVLG
FT                   EDIGVALDVIGDILTNSVFDAGELAREKGVILQEYAAVEDTPDDVVYDAFTEAAFPDQP
FT                   IGRPILGRPETIQSFDRRAIEVYLAREYTPDRMVLAAAGAVEHEAIVEAAERHFGALPA
FT                   RTAPDAEAGLYLGGERRMLRKLEQANLVLGLPGLSFRDEGYYALHLFAQVLGGGLTSRL
FT                   WHEVRETRGLAYEIHAFHWPFSDCGLFGIGAGTAGADLPALVEVTVACLGNAAASIEET
FT                   ELARAKAQLKVSLLSALETPGGRIERIARQILAWGRVIPAEEIIAKVDAVTPEQVRAAG
FT                   RAVMAGAPTLAAIGPIRKLPSLDAVGNALKAA"
     gtgaacgagc atttcgcgac cttcggcgcc tcgccctcct tgcgcatcac gcgcctgccg        60
     aacggtctca cggtcgcgac cgagccgatg ccgggcgtcg ccaccgcgac gctcggcgtc       120
     tgggtcgggg cgggatcgcg ccatgagcgg ccgcaggagc acgggctcag ccacctcatc       180
     gagcacatgg ccttcaaggg cacgtgccgg cgcagcgccc gggccatcgc cgaggacatc       240
     gagaatgtgg gcggcgacat caacgccgcc accagcgccg agcagacgag ctacaccgcc       300
     cgggtgctcg gcgaggatat cggggtcgcc ctcgacgtga tcggcgacat cctgacgaac       360
     tcggtcttcg acgcgggcga gctcgcccgc gagaagggcg tgatcctgca ggaatacgcc       420
     gccgtcgagg acacgccgga cgacgtggtc tacgatgcct tcaccgaggc ggccttcccc       480
     gaccagccga tcggccgccc gatcctcggc cggcccgaga cgatccagag cttcgaccgg       540
     cgggcgatcg aggtctatct cgcccgcgaa tacacgcccg accgcatggt gctggcagcg       600
     gccggcgccg tggagcacga ggcgatcgtc gaggcggccg agcgccattt cggagccctg       660
     ccggcccgca cggcgcccga cgcggaagcg ggcctgtatc tcggcggcga gcggcggatg       720
     ctgcgcaagc tcgaacaggc gaacctcgtc ctcggcctgc ccggcctctc tttccgggac       780
     gagggctatt acgcgctcca cctcttcgcg caggtgctcg gcgggggcct gacctcccgg       840
     ctctggcacg aggtgcgcga gacccgcggc ctcgcctacg agatccatgc cttccattgg       900
     cccttctcgg attgcggcct gttcgggatc ggcgcgggca cggccggcgc cgatctgccg       960
     gccctggtcg aggtcacggt cgcgtgcctg ggcaatgccg ccgcctcgat cgaggagacg      1020
     gagctcgccc gcgccaaggc gcagctcaag gtctcgctgc tctcggccct ggagacgccc      1080
     ggcgggcgaa tcgagcgcat cgcccgccag atcctcgcct ggggccgggt gatcccggcc      1140
     gaggagatca tcgccaaggt cgatgcggtg acgcccgaac aggtgcgcgc cgcggggcgc      1200
     gccgtgatgg cgggcgcccc gaccctcgcg gcgatcgggc cgatccgcaa gctcccgagc      1260
     ctcgacgcgg tcggaaacgc cctcaaggct gcctga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page