(data stored in ACNUC7421 zone)

EMBL: CP001349.PE262

CP001349.PE262       Location/Qualifiers
FT   CDS_pept        300357..303236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0270"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC-like protein"
FT                   /note="KEGG: met:M446_2339 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; Diverse 7TM
FT                   receptor extracellular region 2; Diverse 7TM receptor
FT                   transmembrane region; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55314"
FT                   /db_xref="GOA:B8I9R1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL55314.1"
FT                   /translation="MRHASLALALLVALAGALLPSAARALEAVRVGLDAQAIDLTPAIE
FT                   RYRSDGDLIQISTAPGKDGIVRRIAVKARETGARPDWIVFALTNDTDEQIDRLLVAPHF
FT                   RLVGSGIIWPDLGGSRIAAITASQGIRPERDESPDADQFTVTLDPGTTVTFVAELRTPN
FT                   VPQLYLWDQDAYRKKATGLTLYKGIIIGIAGLLALFLTVVFVVKGAIIFPAAAALAWSV
FT                   LAYTCIDFGFFQRIFPVTEAAERVYRASAEAVLGATLLVFLFAYLNLARWHVRYSHVAL
FT                   LWLIFLAGLVALAVVDPPVAAGVARISIATVAGVGLLLVVYLAAHNGYDRAILLIPTWL
FT                   LLTAWVVAAGFAITGQLRNDLVQPALIGGLVLIVMLIGFTVLQHAFAGGGIGTAVVSDT
FT                   ERRALALTGAGDVVFDWDVPGDRVFAGPEIESQLGLKRGALEGPAANWLALLHPFDVDR
FT                   YSAALDTVIEERRGRICQDFRLRAAAGPYYWFRLKARPVIGADGEVIRIVGTIADVTEV
FT                   KIAEERLLHDAVHDNLTGLPNRELFNDRLDAALTLAAQDPRLKPTVFVLDIDRFKQVND
FT                   AIGLSAGDSILLTLSRRLGRLLRPQDTLARIAGDELAVILVSERDPDRIIAFADMIRRA
FT                   ITTPITYADREIFLTPSIGVVLHEAGSNPKRDQIFKNAEIAMIQAKRQGGDRIEVYRPT
FT                   MRSDRGDRLMLESDLRQALERNEIKVLFQPIVRLEDRTVAGFEALLRWDHPKHGRIPPQ
FT                   TFIPIAEESGLIVDLGVFALERTAAELAAWQQALVVEPPLFASVNVSSRQLLRHDLLHD
FT                   VKTVLARTGVAPGSLKLELTESLVMENPEYAAQMLARIAELGAGLSLDDFGTGYSALAY
FT                   LQRFPFDTIKIDQSFVRQMANGRSVILRSIVRMAQELGLEIVAEGAETEADARALAEIG
FT                   CDYAQGFAFGEPMSVHQARQLVGAAPAAA"
     ttgcgccacg cctcccttgc cctcgccctc ctcgtcgccc tcgcgggggc gctcctgccg        60
     tccgcggcgc gcgcgctgga ggcggtgcgg gtcgggctcg acgcccaggc gatcgacctc       120
     acgcccgcca tcgagcgcta ccgctccgac ggcgacctga tccagatctc gacggcgccc       180
     ggcaaggacg gcatcgtccg gcgcatcgcc gtgaaggcgc gcgagaccgg ggcgcggccg       240
     gactggatcg tcttcgcgct caccaacgac accgacgagc agatcgaccg gcttctcgtc       300
     gcgccgcatt tccgtctcgt cggctcgggc atcatctggc cggatctcgg cggctcgcgc       360
     atcgcggcga tcaccgcgag ccagggcatc cggcccgagc gcgacgagag cccggatgcg       420
     gaccagttca ccgtcacgct cgatcccggc acgaccgtca ccttcgtggc ggagctgcgc       480
     acccccaacg tgccgcagct ctacctctgg gaccaggacg cctaccgcaa gaaggcaacc       540
     gggctcaccc tctacaaggg catcatcatc ggcatcgcgg ggctcctcgc gctcttcctc       600
     accgtcgtgt tcgtggtgaa gggcgcgatc atctttcccg ccgcggcggc gctggcctgg       660
     tcggtgctgg cctatacctg catcgatttc ggcttcttcc agcggatctt cccggtcacg       720
     gaggcggccg agcgggtcta ccgcgcctcc gcggaggcgg tgctcggcgc gacgctgctc       780
     gtcttcctgt tcgcctacct caacctcgcc cgctggcacg tgcgctacag ccacgtggcg       840
     ctcctgtggc tgatcttcct cgcgggcctc gtggcactcg ccgtcgtcga cccgccggtg       900
     gcggcgggcg tggcgcgcat ctcgatcgcg accgtggcgg gcgtcggcct cctcctcgtc       960
     gtgtatctgg cagcccataa cggctacgac cgggcgatcc tgctgatccc gacctggctt      1020
     ctcctgaccg cctgggtggt ggcggcgggt ttcgcgatca ccgggcagct gcgcaacgac      1080
     ctcgtccagc cggcgctgat cggcggcctc gtgctcatcg tgatgctgat cggcttcacg      1140
     gtgctccagc atgccttcgc gggcgggggc atcggcacgg ccgtggtctc ggacaccgag      1200
     cggcgggcgc tggcgctgac gggtgcgggc gacgtggtgt tcgactggga cgtgcccggc      1260
     gaccgggtct tcgccggtcc ggagatcgag agccagctcg gcctcaagcg cggcgccctc      1320
     gaaggaccgg ccgcgaactg gctggcgctg ctccacccct tcgacgtcga ccgctactcg      1380
     gcggccctcg acacggtgat cgaggagcgc cgcgggcgca tctgccagga tttccgcctg      1440
     cgtgccgccg ccggccctta ttactggttc cggctcaagg cccggccggt gatcggggcg      1500
     gatggcgagg tgatccgcat cgtcggcacc atcgcggacg tgacggaggt gaagatcgcc      1560
     gaggagcgcc tgctccacga tgcggtgcac gacaacctca cgggcctgcc gaaccgcgaa      1620
     ttgttcaacg accggctcga cgccgccctg acgctcgcgg cgcaggatcc gcggctcaag      1680
     cccacggtct tcgtcctcga tatcgaccgc ttcaagcagg tgaacgacgc gatcgggctc      1740
     tcggcgggcg attcgatcct gctcaccctg tcgcgccgcc tcggccggct gctgcgcccg      1800
     caggacacgc tggcgcggat cgccggcgac gagctcgcgg tgatcctggt ctccgagcgc      1860
     gaccccgacc gcatcatcgc cttcgcggac atgatccggc gcgccatcac cacgccgatc      1920
     acctacgcgg accgcgagat cttcctgacg ccctcgatcg gggtggtgct gcacgaggcg      1980
     ggcagcaatc cgaagcgcga ccagatcttc aagaatgccg agatcgccat gatccaggcc      2040
     aagcgccagg gcggtgaccg gatcgaggtc taccggccga ccatgcgctc ggaccgcggc      2100
     gaccggctga tgctggagag cgacctgcgc caggcgctcg aacgcaacga gatcaaggtg      2160
     ctgttccagc cgatcgtccg gctggaggac cgcacggtcg cggggttcga ggcgctgttg      2220
     cgctgggacc atcccaagca cgggcgcatc cccccccaga ccttcatccc gatcgcggag      2280
     gaatccggcc tcatcgtcga tctcggcgtc ttcgcgctgg agcgcacggc ggcggagctc      2340
     gccgcctggc agcaggcgct ggtggtcgag ccgccgctct ttgcctccgt caacgtctcc      2400
     tcgcgccagc tcctgcgcca cgacctcctg cacgacgtga agacggtgct cgcccgcacc      2460
     ggcgtcgccc ccgggtcgct caagctcgaa ctcaccgaga gcctggtgat ggagaacccg      2520
     gaatacgccg cgcagatgct cgcccgcatc gccgaactcg gcgccggcct ctccctcgac      2580
     gatttcggca ccggctactc ggcgctggcc tatctccagc gcttcccgtt cgacacgatc      2640
     aagatcgacc aatccttcgt gcgccagatg gcgaacggcc gctcggtgat cctgcgctcg      2700
     atcgtgcgga tggcgcagga gctggggctc gagatcgtgg ccgagggtgc cgagaccgag      2760
     gcggatgcgc gggcgctggc ggagatcggg tgcgattacg cgcagggctt cgccttcggc      2820
     gagccgatgt cggtccatca ggcccgccag ctcgtgggag cggcgccggc cgccgcgtga      2880
//

If you have problems or comments...

PBIL Back to PBIL home page