(data stored in ACNUC7421 zone)

EMBL: CP001349.PE263

CP001349.PE263       Location/Qualifiers
FT   CDS_pept        complement(303441..304421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0271"
FT                   /product="transposase IS111A/IS1328/IS1533"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: gdi:GDI1409
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55315"
FT                   /db_xref="GOA:B8I9R2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R2"
FT                   /inference="protein motif:PFAM:PF01548"
FT                   /protein_id="ACL55315.1"
FT                   /translation="MQGKEVSKQETAGKSSVGIDVSKSWLDVHVLPSGQAQRFANTEVG
FT                   IRQLKRWLGRFALGLVVVEATGKWHRQTRRSLHASGLPVAVVDPFRVRMFAKAQGIWAK
FT                   TDRLDARVLAQFAAVMAPPQRPPASDALEALQELVAARDSAVAEQTALKNQLAAAASPF
FT                   LIRQFQDRLARIAADIEALAGEIRRLIAADPGLARRHAILVSIPSIGDTIAATLVASLA
FT                   ELGTCSSRQIGLLAGLAPVADDSGARQGVRVIWGGRPPVRRVLYLAALSAARHNAGLKA
FT                   FHERLIANGKKPKCAIIAVARKLAVLANSLIAQDRLWTPNQPQQA"
     atgcaaggca aggaagtgtc caaacaagag accgcgggca agtctagcgt ggggatcgac        60
     gtcagcaaga gctggctcga cgtccacgtc ctcccctccg gccaagccca gcggttcgcc       120
     aataccgagg tcggcatccg gcagctcaag cgctggcttg ggcgctttgc tctggggctg       180
     gtcgtggtcg aggccaccgg caagtggcac cgccagaccc gccgcagcct gcatgcctcg       240
     ggcctgccgg tcgccgtcgt cgatccgttt cgggtgcgca tgttcgccaa ggcgcaaggc       300
     atctgggcca agaccgatcg gctcgatgcc cgcgtgctgg cgcagtttgc cgcggtgatg       360
     gcccccccgc agcgcccgcc ggcctcggac gcgctcgaag cgctccagga actggtcgcg       420
     gcccgcgaca gcgccgtggc cgaacaaacc gccctcaaga accagctggc cgcggccgca       480
     agcccgttcc tgatccgcca gttccaggac cgtctggcca ggatcgccgc ggacatcgag       540
     gcccttgccg gcgagatccg ccggctcatc gcggccgatc ccggactggc ccggcggcat       600
     gccatcctgg tctcgatccc ctcgatcggg gacacgatcg cggccaccct ggtggccagc       660
     ctggccgagc tgggcacctg cagcagccgg cagatcggcc tgctggcggg cctggcgccg       720
     gtcgccgacg attccggcgc gcgccagggc gtgcgggtca tctggggcgg ccgcccgccc       780
     gtgcgccgcg tcctctacct cgcggcgctc tcggccgccc gccacaacgc cggcctgaaa       840
     gccttccacg aacgcctgat cgccaacggc aagaagccaa agtgcgccat catcgccgtg       900
     gcccgcaagc tcgccgtgct ggccaacagc ctcatcgctc aggaccgcct ctggacgcca       960
     aatcagcccc aacaggcttg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page