(data stored in ACNUC7421 zone)

EMBL: CP001349.PE264

CP001349.PE264       Location/Qualifiers
FT   CDS_pept        complement(304972..305358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0272"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: met:M446_2338 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55316"
FT                   /db_xref="GOA:B8I9R3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R3"
FT                   /inference="similar to AA sequence:KEGG:M446_2338"
FT                   /protein_id="ACL55316.1"
FT                   /translation="MLTGRRILIVEDEMLIALELSDVVADAQGCPIGPVRSNREALVLL
FT                   DREPVDVAILDLNLADGEATPTAERLIGSGIPVLVCTGGVLPRAMRLMWPDLPVHRKPV
FT                   SADRLIRTLEALCGAPQAAGDAHA"
     atgctgactg gccggcgcat cctgatcgtc gaggacgaga tgctgatcgc tctggaactg        60
     tccgacgtcg tcgcggatgc gcagggctgc ccgatcggac cagtgcggtc gaaccgggag       120
     gccctggtgc tcctcgaccg ggagcctgtc gacgtcgcga tcctcgacct caaccttgcg       180
     gatggcgagg cgacgccgac ggccgagcgg ctgatcggca gcgggattcc cgtgctggtc       240
     tgcacgggcg gcgttctgcc ccgcgccatg cgcctgatgt ggcccgacct gccggtccac       300
     cgcaagccgg tgagcgccga ccggctgatc cggaccctcg aggccctgtg cggcgccccg       360
     caagccgccg gagacgcgca tgcctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page