(data stored in ACNUC7421 zone)

EMBL: CP001349.PE265

CP001349.PE265       Location/Qualifiers
FT   CDS_pept        305613..305954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55317"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R4"
FT                   /inference="similar to AA sequence:KEGG:M446_2337"
FT                   /protein_id="ACL55317.1"
FT                   /translation="MGEAARDEAWQDRAPDSSSLLRRLLLRPVPRLPAPPLDAGVEDII
FT                   DEEDLEEALSRLEAENLVIKAALKSERAEAAELRAQLESLSETETADDLRADRDRWATL
FT                   VERLLFAGR"
     atgggcgagg cggcacggga cgaggcgtgg caggatcggg ccccggactc gtcgagcctt        60
     ctgcggcgat tgctgctgcg ccccgtcccg cgcctccccg cgcctcccct cgacgccggg       120
     gtggaagaca tcatcgatga ggaggatctg gaggaggccc tctcgcggct cgaagccgag       180
     aacctcgtca tcaaggcggc cctgaaatcc gagcgcgcgg aagccgcgga gctgcgggcc       240
     caactggaat ccctgagcga gacggagacc gcagacgacc ttcgcgccga ccgtgatcgc       300
     tgggcaacgc tcgtcgagcg gctgctcttt gccggccgct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page