(data stored in ACNUC7421 zone)

EMBL: CP001349.PE266

CP001349.PE266       Location/Qualifiers
FT   CDS_pept        305998..306963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0274"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: met:M446_2336 oxidoreductase
FT                   FAD/NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55318"
FT                   /db_xref="GOA:B8I9R5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R5"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACL55318.1"
FT                   /translation="MASRPRCSLVLNGKTVRVATGDTPLEAALTAGVAAGHDGIVQDAI
FT                   PRLPKTSRTRPRLGDGATRQGPAPSPLAALRAAKRAGTVLSVTPLSDAVREVVVTVSRP
FT                   LDIQPGQAMEVAFSGFPARPLCPTQRLDGATELNELVFHLRRDTHLGSALGEAVGPGHA
FT                   VRLRGPVGPASYRPGTGRLVLVSAETGFAPIWAIARAARHLEPEREMVLIAGARDAADL
FT                   YMRPALAWLRGTGVTRITLVAAVNRIGVPDVRPGPIAAHLPPLLTSDCVHAAGAPDVVR
FT                   AVERLAAEAGASCAAIPFLPQLSRARSLVTPGEPDATHRR"
     atggcgtccc gcccgcgctg ctcgctcgtc ctcaacggca agaccgtccg cgtcgcgacg        60
     ggcgacacgc ccctggaggc ggcgctcacg gccggcgtcg ccgccggcca tgacgggatc       120
     gtccaggatg cgatcccgcg cctgcccaag accagccgca cccgcccgcg gctcggcgac       180
     ggcgccaccc gccaggggcc ggccccctcc cctctggcgg ctctgcgcgc cgccaagcgc       240
     gccggcaccg ttctgtccgt cacgcccctg tcggacgccg tccgcgaggt ggtcgtcacc       300
     gtctcgcggc ccctggacat ccagccgggg caggcgatgg aggtcgcctt ctcgggcttc       360
     ccggcccggc ccctctgccc gacccagcgg ctcgacggcg cgacggaact caacgaactc       420
     gtcttccacc tgcgccggga cacccatctc ggcagcgccc tcggcgaggc ggtcggcccc       480
     ggccatgcgg tgcgcctccg gggcccggtg ggcccggcgt cctatcggcc cgggaccgga       540
     cggctcgtgc tcgtctccgc cgagaccggc ttcgcgccga tctgggccat cgcgcgcgcc       600
     gcgcgccacc tggagccgga gcgcgagatg gtgctgatcg ccggcgcccg cgacgcggcc       660
     gacctctaca tgcgcccggc cctggcctgg ctgcgcggga ccggcgtcac gcggatcacc       720
     ctcgtggcgg cggtcaaccg catcggtgtg cccgacgtgc gtcccggccc gatcgccgcg       780
     catcttccgc cgctcctcac cagcgactgc gtccacgcgg cgggcgcacc ggacgtcgtc       840
     cgggcggtcg agcggctggc ggcggaagcc ggcgcgtcct gcgcggcgat ccccttcctt       900
     ccccaactga gccgcgcgcg cagcctcgtc acgcccggag agccggacgc gacgcacagg       960
     cggtga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page