(data stored in ACNUC7421 zone)

EMBL: CP001349.PE267

CP001349.PE267       Location/Qualifiers
FT   CDS_pept        307042..309747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0275"
FT                   /product="ABC-type multidrug transport system ATPase and
FT                   permease components-like protein"
FT                   /note="KEGG: met:M446_2335 ABC-type multidrug transport
FT                   system ATPase and permease components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55319"
FT                   /db_xref="GOA:B8I9R6"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R6"
FT                   /inference="similar to AA sequence:KEGG:M446_2335"
FT                   /protein_id="ACL55319.1"
FT                   /translation="MERDPIAFAWRSAPRQHTAAIAVAVGLGTPVVALGLALMRDLVDE
FT                   LLAVADPAGPLLLLLRVSLPLPERLGGTITLLPGWPVDAAEMTLWAVGGLAAVALALAA
FT                   LGWLTARLCFAAQGAAIERLRHRAAEAILRSGPAGREEARALGHQVGEALRAVDALLAV
FT                   GLLVPALTAGAVLLALLVAAAAAPRLVPAVAVSVVAAALARALLNIRANRQSEQRREES
FT                   SALERALADLVRRLPAVRAHGTAAFERARLGHAAHSARRGLARAEASLARARAPALALF
FT                   VLLPAIVLATALWQGEGPPRPVTAGALAAAFGALALAASLLALFLRQTERRRAALPAFR
FT                   EISRIVASLEARARAVRRHGPAARFPASGAVALAGVAAYDPASGERLTGLDLVLPMPSH
FT                   VAILGGRGSGGRVLAALIAGQLEPTVGRVTYAGIDLRALDSSERARRIAFAGDEPVLMA
FT                   GSLLQNLLYGDLAFVDGSAPDPEAPAAHAPHLEERLVEALAVTGLDALVTARGLASLVS
FT                   RTIDPATAAAIVETRGALRAALAAENAAHLIEPFDPHRYNAQATVGENILFGKPVGSAF
FT                   SEGRLASHPFTRAVLEAEGLTRPMIEMGLSIARATVEIFSDLPDDHPLFDAFSLFPAAE
FT                   RGFFEDLVARQPEATGWRRGPAGQRDRARLIGLALRYSETRHRFGLIDAAFEERLVAAR
FT                   HTFAALLPASLRPAVEFYDPGKVTVAASLEENLLFGRIAGAEAGAGTRVRAVMQRVLAE
FT                   RGLERTVFRLGLSARVDPRAAESSLGARDGVLTPAERSAIDLARCLVRQPDILVVGLAL
FT                   DERSPGEIRAGLARLRAARAGRGLVVCLPDEASLSPDAPFDAVIRAERNTALLLAPSGP
FT                   PNESTLLRRAADPGNFADETAVRDGVTAWR"
     atggagcggg atccgatcgc gttcgcgtgg cgcagcgccc cgcgccagca tacggcggcc        60
     attgccgtcg cggtgggcct cggcacgccc gtggtggcgc tcggcctcgc cctgatgcgc       120
     gacctcgtgg acgagctcct tgccgtcgcc gacccggccg ggccccttct gctcctcctg       180
     cgcgtgtcgc tgccgctgcc cgaacgactc ggcgggacga tcaccctttt gcccggctgg       240
     ccggtcgatg cggcggagat gacgctctgg gcggtcggcg ggctcgcggc cgtcgcgctc       300
     gccctcgccg ccctcggctg gctgacggcc cggctctgct tcgcggcgca gggggccgcc       360
     atcgagcggc tgcggcaccg ggctgccgag gcgatcctgc ggtccggccc cgccggccgg       420
     gaggaggcgc gggcgctcgg ccatcaggtc ggcgaggctc tccgggcggt cgacgcgctc       480
     ctcgccgtcg gcctcctcgt gccggcgctg acggcgggtg cggtgctcct ggcgctcctc       540
     gtcgcggcgg cagcggctcc gcgcctggtt ccggccgtgg cggtgagcgt ggtggcggcg       600
     gcgctcgccc gcgcgctgct caacatccgt gcgaaccgcc agagcgagca gcggcgggag       660
     gagagctcag ccctggagcg cgccctcgcc gatctggtgc ggcggcttcc cgccgtgcgg       720
     gcgcatggca cggcggcctt cgagcgcgcc cggctcggcc acgcggccca ttcggcccgg       780
     cgcggactcg cccgggcgga ggcgtccctc gcccgggcac gggccccggc cctggcgctc       840
     ttcgtcctgc tgccggccat cgtgctggcg accgcgctct ggcagggcga gggcccgccg       900
     cgcccggtca ccgcgggggc gctggccgcc gccttcgggg cgctggcgct cgccgcgagc       960
     ctgctcgccc tgttcctgcg ccagaccgag cgccgccgtg cggcccttcc ggccttccgg      1020
     gagatcagcc gtatcgtggc ctccctggag gcacgggccc gggccgtccg acgccacggc      1080
     ccggccgccc ggtttcctgc ctccggcgcc gtggcgctgg cgggcgtcgc cgcctacgat      1140
     cccgcctcgg gcgagcgcct gaccgggctc gacctcgtcc tgccgatgcc gagccacgtg      1200
     gccattctcg gagggcgcgg cagcggcggg cgcgtgctgg ccgccctgat cgccggccag      1260
     ctcgaaccca cggtcggccg cgtgacctat gcgggcatcg acctgcgggc gctcgattcg      1320
     tcggagcggg cgcgccgcat cgccttcgcg ggcgacgagc cggtgctgat ggccggcagc      1380
     ctgctgcaga acctcctcta cggcgacctc gccttcgtgg acggttcggc gcccgatccg      1440
     gaggcgccgg ccgcccatgc gccgcacctg gaggagcggc tcgtcgaggc tctcgccgtg      1500
     accggtctcg atgccctggt caccgcgcgc gggcttgcca gcctcgtgtc gcgcaccatc      1560
     gacccggcca ctgcggccgc gatcgtggag acgcgcgggg cgctgcgcgc cgccctcgcg      1620
     gcggagaacg ccgctcacct gatcgagccc ttcgatccgc accgctacaa cgcccaggcg      1680
     acggtcggcg agaacatcct gttcggcaag ccggtcggca gcgccttctc cgaggggcgg      1740
     ctcgcgagcc atcccttcac ccgcgcggtg ctggaggccg aggggctcac ccgtccgatg      1800
     atcgagatgg gcctttccat cgcccgggcg accgtcgaga ttttttccga tctccccgac      1860
     gaccacccgc tcttcgacgc gttctcgctg tttccggccg ccgagcgcgg cttcttcgag      1920
     gatctggtgg cgcgccagcc ggaggcgacg ggctggcggc gggggccggc cgggcagcgc      1980
     gaccgcgccc ggctgatcgg gctcgcgttg cgctacagcg agacgcggca ccgcttcggc      2040
     ctcatcgacg ccgccttcga ggagcggctg gtcgccgccc gccacacctt cgcggccctg      2100
     ctgccggcct ccttacgccc ggcggtggag ttctacgacc ccggcaaggt cacggtggcg      2160
     gcgagcctgg aggagaacct gctgttcggc cgcatcgcgg gcgccgaggc cggagccggg      2220
     acgcgggtgc gcgccgtcat gcagcgggtg ctggccgagc gcggcctcga acggaccgtc      2280
     ttccgcctcg gtctctccgc ccgggtcgat ccccgcgccg ccgagagcag cctcggcgcc      2340
     cgggacgggg tcctgacgcc ggccgagcgc agcgcgatcg acctcgcccg ctgcctcgtg      2400
     cgccagcccg acatcctcgt cgtggggctg gccctcgacg agcgcagccc gggggagatc      2460
     cgcgcgggcc tcgcgcggct gcgcgcggcg cgggcggggc ggggtctcgt cgtctgcctg      2520
     ccggacgagg cgagcctgtc gccggacgcc cccttcgacg cggtgatccg cgccgagcgc      2580
     aacacagcgc tgctccttgc accctccggg ccgccgaacg agtccaccct cttgcgccgc      2640
     gccgcggatc cggggaactt cgcggacgag acagccgttc gtgatggagt gaccgcgtgg      2700
     agatga                                                                 2706
//

If you have problems or comments...

PBIL Back to PBIL home page