(data stored in ACNUC7421 zone)

EMBL: CP001349.PE268

CP001349.PE268       Location/Qualifiers
FT   CDS_pept        309848..310774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0276"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="KEGG: met:M446_2334 beta-lactamase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55320"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R7"
FT                   /inference="similar to AA sequence:KEGG:M446_2334"
FT                   /protein_id="ACL55320.1"
FT                   /translation="MRSRTFFCDEADHHPRMTQEGLTAPGDLTLRFWGVRGSICASGPN
FT                   FVEFGGHTPCVEIRCGERLFVIDAGTGLNALGAHHGADLPQRIDLLFSHLHLDHVTGLA
FT                   FLKPAVLDKNREIHTYCGNLDGQSAEEPLNRLFSPPLFPITLDALPARFVHHGFRAGET
FT                   LTFPDGMEVDTLPLQHPQGATGYRFRHAGRTACYISDIEHSEPWPERNLLHFVEGADLI
FT                   LYDGMFTEGEYPSCRGWGHSTWEKGVELCRAAKVGRLGIIHLYPQHGDAMLRDMEQAMQ
FT                   AAMPTAFICRERQKIVLPAEVRVPELA"
     gtgcgaagcc gcacattctt ttgcgacgaa gcggatcacc atccgcgcat gacacaagag        60
     ggtctcactg cgccgggtga cctgacgctt cgcttctggg gcgtgcgggg gtcgatctgc       120
     gcgtccggcc cgaacttcgt ggagttcggg gggcacacgc catgcgtcga gatccgctgc       180
     ggcgagcgtc tgttcgtcat tgatgcgggc acgggcctca atgcgttggg cgcccatcac       240
     ggggccgacc tgcctcagcg catcgacctg ctgttcagcc acctgcatct cgaccacgtc       300
     accgggctcg ccttccttaa acccgcggtg ctcgacaaga atcgcgagat ccacacctat       360
     tgcggcaatc tcgacgggca gagcgccgag gagccgctga accgcctgtt ctcgccgccg       420
     ctcttcccga tcaccctcga cgccctgccg gcacgcttcg tccatcacgg ctttcgcgcg       480
     ggcgagaccc tgaccttccc ggacgggatg gaagtcgaca cgctgccgct gcagcatccg       540
     cagggcgcca ccggctaccg cttccgccat gcgggccgca ccgcctgcta catcagcgac       600
     atcgagcaca gcgagccctg gcccgaacgg aacctgctgc acttcgtgga gggggccgac       660
     ctcatcctct acgacggcat gttcaccgag ggcgagtatc cgtcctgccg cggctggggc       720
     cactccacct gggagaaggg cgtggaattg tgccgggccg cgaaggtcgg ccgactcggc       780
     atcattcacc tctatcccca gcacggcgac gcgatgctgc gggacatgga gcaggccatg       840
     caggccgcga tgccgaccgc cttcatctgc cgcgagcggc agaagatcgt gctgccggcc       900
     gaggtcaggg tgcccgaact cgcctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page