(data stored in ACNUC7421 zone)

EMBL: CP001349.PE269

CP001349.PE269       Location/Qualifiers
FT   CDS_pept        complement(310905..311918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0277"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   met:M446_2333 high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55321"
FT                   /db_xref="GOA:B8I9R8"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R8"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ACL55321.1"
FT                   /translation="MLVRSASLPLVPARGAILRVGLALAAVAAAAFLLAGLVALLAPGF
FT                   APPPRSPFGMGFREAAPSGAGSLGAWLLAMQAAFSRSLQAAVSAVRTGQGGYGLLAGLG
FT                   FAYGIFHAAGPGHGKAVIAGYIVAGERALARGVTLSAAAALLQAMVALALVGGGAALLR
FT                   LTAAGLTEAGRWIETAGFACVALLGLAVTWRKAGALAARLQGGSAAPCGPECGHAVLAD
FT                   ARRIERLGTWREQAGVVIAAGTRPCAGAILVLVFALSQGVFLAGVLATLAMALGTALTT
FT                   SALAALAVFAKALALRLAGGRGEAGAVAVGTLELLAAAFVLVLGTALLAGYAAAIV"
     gtgctcgtga gatccgcctc tctcccgctt gtgccggccc gaggggccat cctgcgcgtg        60
     gggcttgccc tcgcggccgt ggccgcggcg gccttcctcc tcgcggggct cgtcgcgctc       120
     ctggcgccgg gcttcgcgcc gccgccgcgc tcgcccttcg gcatgggatt tcgcgaggcg       180
     gccccctccg gagcggggag tctcggcgcg tggctgctcg ccatgcaggc ggccttctcg       240
     cgcagcctcc aggctgccgt ctcggccgtc aggacagggc aggggggcta cggtctcctc       300
     gccggcctcg gcttcgccta cggcatcttc catgccgccg gcccggggca cgggaaggcg       360
     gtgatcgcgg gctacatcgt ggccggagag cgggcgctcg cccggggggt gacgttgagt       420
     gccgcggcgg ccttgctgca ggccatggtg gcgctcgcgc tcgtcggcgg cggcgcggcg       480
     ctgctgcgcc tcaccgcggc cgggctgacc gaggccggcc gctggatcga gactgcgggt       540
     ttcgcctgcg tggcgctcct cggcctcgcc gtgacttggc gcaaggcggg cgcgctggcc       600
     gcccgcctgc agggggggag cgccgcaccc tgcggtccgg aatgcggcca cgcggttctg       660
     gcggatgcgc ggcggatcga gcggctcggc acctggcggg agcaggcggg cgtcgtcatc       720
     gcggcgggca cccgcccctg cgccggggcg atcctcgtcc tggtcttcgc gctgtcccag       780
     ggcgtctttc tcgccggggt actcgccacg ctggcgatgg cgctcggcac cgccctcacc       840
     acctcggccc tcgccgcgct cgctgtcttc gccaaggcgc tggcgctgcg cctcgcgggc       900
     ggacgcgggg aggcaggtgc cgtcgcggtc gggacgctcg aactcctggc agcggccttc       960
     gtgctcgtgc tcggcaccgc ccttctcgcc ggctacgcgg cggcgatcgt ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page