(data stored in ACNUC7421 zone)

EMBL: CP001349.PE27

CP001349.PE27        Location/Qualifiers
FT   CDS_pept        complement(29036..29338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0028"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   met:M446_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55079"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT17"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ACL55079.1"
FT                   /translation="MSAPPAFACQACGACCAYSADWPRFSTEDEAALAAIPAAYVDDPA
FT                   GRMRCEGDRCSALAGEVGVAVTCRVYAVRPEVCRTCEPGDPECLTARRRFGLPVP"
     gtgagcgcgc cgcccgcctt cgcctgccag gcctgcggcg cctgctgcgc ctattcggcc        60
     gactggccgc gcttctcgac cgaggacgag gcggcgctcg cggcgatccc ggcggcctat       120
     gtggatgatc cggccggtcg gatgcgctgc gagggcgacc gctgcagcgc gctcgcgggc       180
     gaggtcggcg tcgcggtgac ctgccgcgtc tacgcggtgc ggcccgaagt ctgccgcacc       240
     tgcgagccgg gcgatccgga atgcctgacg gcgcggcgcc ggttcggcct gcccgtcccc       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page