(data stored in ACNUC7421 zone)

EMBL: CP001349.PE270

CP001349.PE270       Location/Qualifiers
FT   CDS_pept        complement(311909..312553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0278"
FT                   /product="protein of unknown function DUF1007"
FT                   /note="PFAM: protein of unknown function DUF1007; KEGG:
FT                   met:M446_2332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55322"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R9"
FT                   /inference="protein motif:PFAM:PF06226"
FT                   /protein_id="ACL55322.1"
FT                   /translation="MPGVTKPIRLRVPALAGVLLAASLSAAHAHPHVWVTTRAEFVFAP
FT                   DGRVTAIRHAWTFDPSYSAFTVQGLGQGIPNAEALAALARDNVEALGDSGYFTSLKVDG
FT                   RRQDFSGPEAPAMTYADGQLTLHFTLPLKAPARGALALEVYDPTYFVAFSLAEGDAVAA
FT                   LKGAPSGCKAVAHRPKSAPPQTGMSESFFAALTDAANYGVQFANRIIVSCS"
     gtgccgggcg tgaccaagcc gattcgattg cgcgtccccg ccctggccgg ggtcctgctt        60
     gccgcgagcc tcagcgcggc ccatgcccac ccgcatgtct gggtcacgac ccgggccgag       120
     ttcgtcttcg cccccgatgg ccgcgtcacg gcgatccgcc atgcctggac cttcgacccg       180
     tcctactcgg ccttcacggt gcagggattg gggcagggga tcccgaatgc cgaggcgttg       240
     gcggcgctcg cccgcgacaa tgtcgaggcg ctcggcgact ccggctattt caccagcctg       300
     aaggtcgacg gacgccggca ggacttctcg gggcccgagg cgcccgccat gacctacgcg       360
     gacgggcagc tcaccctgca tttcacgctg ccgctgaagg ccccggcccg gggcgcgctc       420
     gccctcgaag tctacgaccc gacctatttc gtcgccttca gcctcgccga gggcgatgcg       480
     gtcgcggcgc tgaagggggc gccttccggc tgcaaggccg tcgcgcatcg cccgaagagc       540
     gcgccgccgc agacgggcat gtcggaatcg ttcttcgccg cactcaccga cgcggcgaat       600
     tacggggtgc agttcgccaa ccggatcatc gtctcgtgct cgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page