(data stored in ACNUC7421 zone)

EMBL: CP001349.PE271

CP001349.PE271       Location/Qualifiers
FT   CDS_pept        complement(312607..313533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0279"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2331 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55323"
FT                   /db_xref="GOA:B8I9S0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55323.1"
FT                   /translation="MGSRRLPPLNAVRAFEAAARHATFQAAGDELGVSAGAVAQQVKAL
FT                   EAWFGLPLFRRLPSRGVVLTPAGARFADAAASLLDGVAAAALALRRRSDDTALTINTTH
FT                   SFAALWLIPRIGSFREANPDLHVRIVANNQVIDFTREAADCAIRHGKGGYAGVRTELLL
FT                   RDAVFPVCSPRLRDGVPPLRRLQDLASHTLLHDDDPLDAGMIGWIGWREWLAAVGMPDL
FT                   VAKRGPTFTHTFMVLQAATAGQGVALATRVLGGDLLEPGGLVRPFAEEVPSPYSFFIVT
FT                   PDEPDPPKVAHFRAWLRAQADAPLSPQ"
     atgggatcgc gacgcctgcc gccgctcaac gccgtccggg ccttcgaggc ggcggcccgc        60
     cacgccacgt tccaggcggc gggcgatgaa ctcggcgtca gcgcaggcgc ggtggcgcag       120
     caggtcaagg cgctggaggc atggttcggc ctgccgttgt ttcgtcgcct gccgagccgc       180
     ggggtcgtgc tgactccggc gggcgcccgt ttcgccgatg ccgcggcaag cctgctcgac       240
     ggggtggctg cggcggccct ggccctgcgc cgtcggagcg acgacaccgc gctcaccatc       300
     aacacgaccc attccttcgc ggcgctctgg ctgattccgc ggatcgggag cttccgggag       360
     gccaatcccg acctccacgt gcggatcgtc gccaacaacc aggtgatcga cttcacccgg       420
     gaggccgccg attgcgccat ccgccacggc aagggcggct acgcaggggt gcgcacggag       480
     ctgctgctac gcgacgcggt gtttcccgtg tgcagcccgc gcctgcggga cggggtgccg       540
     cccctgcgca ggcttcagga tctcgcgagc cacaccctgc tgcatgacga cgatccgctc       600
     gacgcgggca tgatcggctg gatcggctgg cgggaatggc tcgcggcggt cggcatgccg       660
     gacctcgtcg ccaagcgcgg cccgaccttc acccatacct tcatggtgct gcaggcggcg       720
     accgccggtc agggcgtcgc cctcgcgacc cgcgtcctcg gcggcgacct gctggagccc       780
     ggcggcctcg tgcgcccttt tgccgaggag gtgccgagcc cctattcgtt cttcatcgtc       840
     acgccagacg aacccgatcc gcccaaggtg gcgcatttcc gggcctggct tcgcgcgcaa       900
     gccgacgccc cgctttcgcc gcagtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page