(data stored in ACNUC7421 zone)

EMBL: CP001349.PE272

CP001349.PE272       Location/Qualifiers
FT   CDS_pept        313642..313872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0280"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   met:M446_2330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55324"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S1"
FT                   /inference="protein motif:PFAM:PF06568"
FT                   /protein_id="ACL55324.1"
FT                   /translation="MTVLVTDRGNLRLVPSVSLRPPRPTRAVSVIERLELWAQRHRQRR
FT                   ELQTLSERTLDDIGLSRADVAREADKPFWRG"
     atgacggtgc tcgtcacaga ccgaggaaat ctgcgtcttg ttccctccgt cagcctgcgc        60
     ccgcctcgtc cgacgcgggc ggtgtcggtg atcgagcggc tcgaactctg ggcgcagcgg       120
     cacaggcagc ggcgggagtt gcagacatta tcggagcgga cgctcgacga tatcggcctg       180
     tcccgcgccg acgtcgcccg tgaagcggac aagccgttct ggaggggata g                231
//

If you have problems or comments...

PBIL Back to PBIL home page