(data stored in ACNUC7421 zone)

EMBL: CP001349.PE273

CP001349.PE273       Location/Qualifiers
FT   CDS_pept        complement(313981..316041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0281"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; protein
FT                   of unknown function DUF839; KEGG: chu:CHU_3119 phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55325"
FT                   /db_xref="GOA:B8I9S2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S2"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="ACL55325.1"
FT                   /translation="MAANQTGPSTTQSPYLVPTTDKVAFTSILSAGDTVAGSVKSDGTP
FT                   WRFAGIPDGIGAFDNGNGTATVLVNHELRETTGATRAHGAIGAFVDRLIIDKATLQVRS
FT                   ASDLGTSTFTFNPTTGTYVQGPTTISRLCSADLPAVSAFYDATTGLGTQTRIFMNGEES
FT                   GAEGRAFAWIVNGPEAGRVYELPRLGNFSFENSVANPGSGAKTVSIGLDDSSGGQLYVY
FT                   AGNKQATGTEIEKAGLTNGKLYGIKVPAFAAETNTTSVAAAGTAFTLQEMGPNGDVSAV
FT                   TGAQLEAESTAEGVTAFLRPEDGAWDPTNPNRFYFTTTNAITSPSRLWALDFTDVTRPE
FT                   LGGTVKMLLDGTEGQVMFDNLTVTAEGRVILQEDPGNNARLAKMWQYDPATDALTQLGE
FT                   HDPARFSGLTPPFTQDEESSGVLDVSTIFGGPGRQAFLLDTQAHYAFGSSEIVEGGQLQ
FT                   MMYVDRTINGTAGNDSLVGSQIADLIWGNDGDDTIRGAAGDDYLSGLAGNDSIDGGAGN
FT                   DTLFGDAGDDRVDGGEGDDVVRGWYGNDTLFGSGGNDAVFGEDGHDFIGAGSGNDYVSG
FT                   GAGNDALYGEAGNDLLFGNAGNDELVGGTGSDTFGFGRGDGQDLIRDFTVGGAERDVIA
FT                   FNGGAFASFAAVQAATQQVGADAVISYGAGDTIRLQNTQLASLTADNFTFA"
     atggcagcca accagaccgg accgtcgact acgcaatcgc cctatctcgt cccgaccacc        60
     gacaaggtcg ctttcacctc gatcctgagc gcgggcgaca cggtcgccgg ttccgtcaag       120
     agcgacggaa ctccgtggcg cttcgcgggc atcccggacg gcatcggcgc cttcgacaac       180
     ggcaacggca ccgccacggt gctcgtgaac cacgaactcc gtgagaccac cggcgccacc       240
     cgcgcgcatg gcgcgatcgg tgccttcgtc gaccggctga tcatcgacaa ggcgacgctc       300
     caggtgcgct ccgcgagcga tctcggcacc agcaccttca cgttcaaccc caccaccggc       360
     acctatgtgc agggcccgac caccatctcg cggctctgct cggccgacct gccggcggtt       420
     tcggccttct acgacgccac gaccggcctc ggcacccaga cccgcatctt catgaacggc       480
     gaggaaagcg gcgccgaggg ccgggccttc gcctggatcg tgaacggccc ggaggccggc       540
     cgcgtctacg agcttccgcg cctcggcaac ttctccttcg agaactcggt ggcgaacccg       600
     ggctccgggg ccaagaccgt ctcgatcggc ctggatgatt cgtccggcgg ccagctctac       660
     gtctatgccg gcaacaagca ggcgaccggc accgagatcg agaaggccgg cctcaccaac       720
     ggcaagctct acggcatcaa ggtcccggcc ttcgccgccg agaccaacac cacctccgtg       780
     gccgcggcgg gcaccgcctt cacgctgcag gagatggggc cgaacggcga cgtgtcggcc       840
     gtgaccggtg cccagctgga ggccgagagc accgccgagg gtgtgaccgc cttcctgcgt       900
     ccggaggacg gcgcctggga tccgacgaac ccgaaccgct tctacttcac caccaccaac       960
     gcgatcacca gcccctcgcg gctctgggcg ctcgacttca ccgacgtgac ccgtccggaa      1020
     ctcggcggca cggtcaagat gctgctggac ggcaccgaag gccaggtgat gttcgacaac      1080
     ctgacggtga cggccgaggg ccgggtcatc ctgcaggagg atccgggcaa caacgcgcgc      1140
     cttgccaaga tgtggcagta cgatccggcg acggacgccc tgacccagct cggtgagcac      1200
     gatccggcgc gcttctcggg gctgacgccg cccttcaccc aggacgagga atcctccggc      1260
     gtcctcgacg tcagcacgat cttcggcggt ccgggccggc aggccttcct cctcgacacc      1320
     caggcgcact acgccttcgg ctcgtccgag atcgtcgagg gcggccagct ccagatgatg      1380
     tatgtcgacc ggaccatcaa cggcacggcc ggcaatgaca gcctcgtggg cagccagatc      1440
     gccgacctga tctggggcaa cgacggcgac gacaccatcc ggggcgcggc cggcgacgat      1500
     tacctgtcgg gtcttgcggg caacgattcg attgacggtg gcgcaggcaa cgacacgctc      1560
     ttcggcgatg cgggtgacga ccgggtcgac ggcggtgagg gcgacgacgt ggtgcgcggc      1620
     tggtacggga acgacacgct gttcggcagc ggcggcaacg atgccgtgtt cggcgaggac      1680
     ggacacgact tcatcggcgc gggcagcggg aacgactacg tgtcgggcgg cgccggcaac      1740
     gacgcgctct acggcgaggc gggcaacgac ctgctgtttg gcaatgccgg caacgacgag      1800
     ctcgtgggcg gcaccggctc cgacaccttc gggttcggcc gcggcgacgg ccaggatctc      1860
     atccgcgact tcacggtcgg cggtgcggag cgcgatgtga tcgccttcaa cggcggtgcc      1920
     ttcgcgtcct tcgccgccgt ccaggcggcg actcagcagg ttggcgccga cgcggtgatc      1980
     tcttacggcg cgggcgacac gatccggctg cagaacacgc agctggcgag cctcacggcc      2040
     gacaacttca ccttcgcctg a                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page