(data stored in ACNUC7421 zone)

EMBL: CP001349.PE274

CP001349.PE274       Location/Qualifiers
FT   CDS_pept        316282..317022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0282"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: bra:BRADO0942 putative N-acyl
FT                   homoserine lactone transcriptional regulator, LuxR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55326"
FT                   /db_xref="GOA:B8I9S3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S3"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ACL55326.1"
FT                   /translation="MSGMEDFFLRETFALIDALDEVRDPFEAQTRIFEHIQHVGFTSFT
FT                   ITRLPRPSDRLGPNMLFNMWPKDWLTHYDRVGHYRFDPVVRQCYRTTEPFAWSEVPFDA
FT                   DQPDRARRVMDEAAAFGLGFGFCIPVHDALGFQGGVSLAGERIDLSPKIRRGLHMLGLY
FT                   AWGAATRTTEDRRRSEPGRLLSARERDVLSWAAMGRTREEIATILGVSHETVATHLKSA
FT                   RIKIGARNTTQTVVEALRKREITL"
     atgtcgggca tggaggactt ttttctacgc gagaccttcg cgctgatcga tgcgctcgac        60
     gaggttcggg acccgttcga agcgcagacg cggattttcg agcacatcca gcacgtgggc       120
     tttacctcgt tcaccatcac gcggctgccg cggccgagtg accggctggg cccgaacatg       180
     ctgttcaaca tgtggccgaa ggattggctc acgcattatg accgcgtcgg acattaccga       240
     ttcgatcccg tggtccggca atgctaccgg acgaccgagc ccttcgcgtg gtcggaggtt       300
     cccttcgacg ccgaccaacc ggaccgcgcc cgccgggtga tggacgaagc cgcggcgttc       360
     ggcttaggct tcgggttctg catcccggtg cacgacgcgc tcggcttcca gggcggcgtg       420
     tcgctggcgg gcgagcgcat cgacctctcc ccgaagatcc ggcggggcct gcacatgctg       480
     gggctctacg cctggggcgc ggcgacgcgg accacggagg atcgccgccg cagcgagccg       540
     gggcggctgc tgagcgcccg tgagcgcgac gtgctgtcct gggccgcgat ggggcggacg       600
     cgcgaggaga tcgcgaccat cctcggcgtg tctcacgaga cggtcgcgac ccatctcaag       660
     agcgcccgca tcaagatcgg ggcccgcaac acgacccaga ccgtcgtcga ggcgctgcgc       720
     aagcgcgaga tcacgctctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page