(data stored in ACNUC7421 zone)

EMBL: CP001349.PE275

CP001349.PE275       Location/Qualifiers
FT   CDS_pept        317298..317948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0283"
FT                   /product="autoinducer synthesis protein"
FT                   /note="KEGG: rpb:RPB_0417 autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55327"
FT                   /db_xref="GOA:B8I9S4"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S4"
FT                   /inference="similar to AA sequence:KEGG:RPB_0417"
FT                   /protein_id="ACL55327.1"
FT                   /translation="MIRLHAIDHSNRERYADVLRQHDRLRRRLAAAGRCWSLAAASDDS
FT                   GAVAGQGVDLVALAPCGQVAGGTRLMPTEGPTLLGDVFPHLADMRDAARGPGVWEWTHF
FT                   VVAPRFRGDGRRCHVSGVLAVGLVEHCLARGITRMNVVTETFWVPTASELGWQPRPLGL
FT                   PVERDGVSICAFTVAMTPMALRTTRALYGVADPCLWAPAHSAGRLAPRQTLHA"
     atgatccggc ttcacgccat cgaccacagc aaccgcgagc gctatgcgga cgtgctccgc        60
     cagcacgacc ggctgcgccg gcgccttgcc gccgcggggc gctgctggag cctcgcagcg       120
     gcatccgatg attcgggcgc cgtggcgggg cagggtgtcg atctggttgc gctcgccccc       180
     tgcgggcagg tcgcgggcgg cacacgcctc atgcccacgg aggggccgac gctcctcggg       240
     gacgtcttcc cgcatctcgc ggacatgcgc gatgccgcgc gcggcccggg ggtctgggag       300
     tggacccact tcgtcgtggc gccgcgcttt cgcggcgacg gacgacgctg ccacgtcagc       360
     ggggtgctcg cggtcggcct cgtcgagcat tgtctcgccc gcggcatcac ccggatgaac       420
     gtcgtcaccg agaccttctg ggtaccgacc gcctcggagc tcggctggca gccccggccg       480
     ctcggcctgc cggtcgagcg cgacggcgtg tcgatctgcg ccttcacggt cgcgatgacg       540
     ccgatggccc tgcgcaccac ccgggcgctc tacggcgtcg ccgatccctg cctctgggcg       600
     ccggcccatt ccgccggacg gctcgcaccg cgccagaccc ttcatgccta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page