(data stored in ACNUC7421 zone)

EMBL: CP001349.PE276

CP001349.PE276       Location/Qualifiers
FT   CDS_pept        318025..318345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55328"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55328.1"
FT                   /translation="MRKRSHLTLDEQAKPPSRAGNLMAEIGERAGDDAIVVEVTDNVDL
FT                   SDAVRAELRILRAAAAAIDLQKAVGPQVERMAAVQAMIDAAWAVFAELGRGGPGADDAI
FT                   HH"
     atgcgtaagc gctcccacct caccctggac gagcaagcca agccgccctc acgggccggg        60
     aatctgatgg cggagatcgg cgagcgggcc ggcgacgatg cgatcgtcgt cgaggtgacc       120
     gacaacgtcg acctcagcga cgccgtgagg gcggagctgc gcatcctgcg cgctgctgcc       180
     gcggcgatcg acctccagaa ggccgtcgga ccgcaggtcg agcggatggc ggcggtgcag       240
     gcgatgattg atgccgcctg ggcggtcttc gcggaactcg ggcggggcgg tcccggcgcc       300
     gacgacgcga tccaccattg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page