(data stored in ACNUC7421 zone)

EMBL: CP001349.PE277

CP001349.PE277       Location/Qualifiers
FT   CDS_pept        complement(318648..319217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0285"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="TIGRFAM: crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC;
FT                   KEGG: met:M446_2328 crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55329"
FT                   /db_xref="GOA:B8I9S6"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S6"
FT                   /inference="protein motif:TFAM:TIGR00228"
FT                   /protein_id="ACL55329.1"
FT                   /translation="MVTTEPVRILGIDPGLRRTGWGLITVTGTRLAFVSCGVLTSDGDD
FT                   DLALRLRDLHDGLSRVVAAMQPDEVAVEETFVNKDAQATLKLGHARAVALLVPALAGLP
FT                   VAEYAANLVKKTVVGAGHAEKGQIAAMVRFLLPKADPATADAADALAVAITHAQHRAAR
FT                   ARELACAAPRARPARVGRGASLRTRA"
     atggtgacga ccgaaccggt ccgcatcctc ggcatcgatc cgggccttcg ccgcaccggc        60
     tgggggctca tcacggtcac gggcacgcgg ctcgccttcg tgtcctgcgg ggtgctgacc       120
     tcggacggcg acgacgatct cgccctgcgc ctgcgcgacc tgcatgacgg cctgtcgcgg       180
     gtcgtggcgg cgatgcagcc ggatgaggtc gcggtcgagg agactttcgt caacaaggac       240
     gcccaggcga cgctcaagct cggccatgcc cgcgccgtcg cgctcctggt gccggctctc       300
     gccgggctgc cggtcgccga atacgccgcc aacctcgtga agaagaccgt ggtgggggcg       360
     gggcatgccg agaaggggca gatcgccgcc atggtgcgct tcctgctccc caaggccgat       420
     cccgccaccg ccgacgcggc cgatgcgctc gccgtcgcga tcacccatgc gcagcatcgg       480
     gccgcgcggg cgcgggaact ggcctgtgcg gccccgcggg cgcgtccggc gcgggtcggg       540
     cgcggcgcct cgctccgcac gagggcgtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page