(data stored in ACNUC7421 zone)

EMBL: CP001349.PE278

CP001349.PE278       Location/Qualifiers
FT   CDS_pept        complement(319388..321748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0286"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   mrd:Mrad2831_4404 ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55330"
FT                   /db_xref="GOA:B8I9S7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S7"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ACL55330.1"
FT                   /translation="MDFHRRFTVLMCAPAFDPDDLEGARVNQIVAAVEARGFEVVRARR
FT                   VEDAAIAVQTDAAIGCMVVDWGKRGLDGKAAALIDMMRQRGLEMPIVIMVRRKRLEDIP
FT                   VELLDFIDGYIFLAEETPEFIARGLVSRVTQYAETLKTPFFGALVDYAEKGNQLWTCPG
FT                   HNGGIFYNRSPIGRIFVEHLGEAIFRDDLDNSVLDLGDLLTHEGPALKAQKEAAAIFGA
FT                   EKTYFVLNGTSASNKIVLSALVAEDDLVLFDRNNHKAAHHGALFLGGGIPIFLETDRNA
FT                   HGLIGPIYHEAFDEAAIRDKIRRNPLVRDRQAWRRQRPFRVAVIEQCTYDGTIYDAREI
FT                   LARIGHLCDYILFDEAWAGFMKFHPLYAGRFAMGLDGLGPDSPGIIATQSTHKQLASFS
FT                   QASQIHTKDGHIRGQSRRVEHRRLNESFLVHASTSPFYPLFASLDVGAQMMKGRSGMIL
FT                   WDDTIRLGIEWRKKVRAIRKEFEENEADPQRRWFFDPFVPDLVEGPDGTVLPWESLPTD
FT                   LLASEPRYWELAPGARWHGFTKVAPGYAITDPNKLTVLTPGFDRETGEYAEHGVPAPIV
FT                   AQYLRENRIVPEKNDLNSLLFLLTPGVESSKAGTLISGLVAFKRLHDDNVPLEEAMPDF
FT                   VRRRPRRYQGVRLRDLCAEFHAFHREAGTSTLQRKQFAPEHLPEMAMPPKAAAQMLTRN
FT                   QVDFVPIAEAAGRIATTLMLVYPPGIGTVLPGERLDERAKPMLDYFTMFETSANLFPGF
FT                   EAEIQGVYRQVEPDGRIRFYTYVLREGAGTTAR"
     atggatttcc accgccgctt caccgtcctg atgtgcgcgc ccgccttcga tcccgacgat        60
     cttgagggcg cgcgggtcaa ccagatcgtg gcggccgtgg aggcgcgcgg cttcgaggtg       120
     gtgcgggcgc ggcgggtcga ggatgcggcc atcgcagttc agaccgatgc ggcgatcggc       180
     tgcatggtgg tggattgggg caagcgcggc ctcgacggca aggcggcggc gctcatcgac       240
     atgatgcgcc agcgcggcct ggagatgccg atcgtcatca tggtccgccg caagcggctg       300
     gaggacatcc ccgtcgagct cctcgatttc atcgacggct acatcttcct cgccgaggag       360
     acgcccgaat tcatcgcccg gggcctcgtc tcgcgtgtca cccaatatgc cgagacgctg       420
     aagacgccgt tcttcggcgc cctcgtcgac tatgccgaga agggcaacca gctatggacc       480
     tgccccggcc acaacggcgg catcttctac aaccgctcgc cgatcggccg catcttcgtc       540
     gagcatctgg gcgaggcgat ctttcgcgat gacctcgaca actcggtcct cgatctcggc       600
     gacctcctca cccacgaggg gccggccctg aaggcgcaga aggaggcggc agcgatcttc       660
     ggggcggaaa aaacctattt cgtgctcaac ggcacgtcgg cctcgaacaa gatcgtgctc       720
     tcggcgctgg tggccgagga cgacctcgtg ctgttcgacc gcaacaacca caaggccgcc       780
     catcacggcg ccctcttcct cggcggcggc atcccgatct tcctcgagac cgaccgcaac       840
     gcccatgggc tgatcggccc gatctaccac gaggccttcg atgaggcggc gatcagggac       900
     aagatccgcc gcaacccgct cgtccgggac aggcaagcct ggcgcaggca gcgcccgttc       960
     cgcgtcgcgg tgatcgagca atgcacctat gacggcacga tctacgatgc gcgcgagatc      1020
     ctggcgcgga tcgggcatct ctgcgactac atcctgttcg acgaggcctg ggcgggcttc      1080
     atgaagttcc acccgctcta tgccggccgc ttcgccatgg ggctcgacgg gctcgggccg      1140
     gactcgcccg gcatcatcgc tacgcaatcg acccacaagc agctcgcgag cttcagccaa      1200
     gcctcgcaga tccacaccaa ggacggccat atccgcggcc agagccggcg cgtcgagcac      1260
     cggcggctca acgagagctt cctcgtccac gcctcgacct cgcccttcta cccgctcttc      1320
     gcctccctcg atgtcggcgc ccagatgatg aagggccgct ccggcatgat cctgtgggac      1380
     gacaccatcc ggctcgggat cgagtggcgc aagaaggtgc gggcgatccg caaggagttc      1440
     gaggagaacg aggccgatcc gcagcgccgc tggttcttcg atcccttcgt ccccgacctg      1500
     gtggagggcc cggacgggac cgttctgccc tgggagagcc tgcccaccga cctcctcgcc      1560
     agcgagccgc gctactggga gctcgcgccc ggcgcccgct ggcatggctt cacgaaggtg      1620
     gcgcccggtt acgccatcac cgaccccaac aagctcacgg tgctgacgcc gggcttcgac      1680
     cgcgagacgg gtgagtatgc ggagcacggc gtgccggccc cgatcgtggc gcagtatctg      1740
     cgcgagaacc gcatcgtgcc cgagaagaac gacctgaact cgctcctctt cctgctcacg      1800
     cccggcgtcg aatcctccaa ggccggcacg ctgatctcgg gcctcgtcgc cttcaagcgc      1860
     ctgcacgacg acaacgtgcc gctggaggag gccatgccgg acttcgtgcg gcggcggcct      1920
     cggcgctacc agggcgtgcg gctgcgcgac ctctgcgccg agtttcacgc gttccatcgc      1980
     gaggccggca cctccaccct gcagcgcaag caattcgccc ccgagcacct gcccgagatg      2040
     gcgatgcccc cgaaggccgc cgcccagatg ctgacccgca accaggtcga cttcgtgccg      2100
     atcgccgagg cggcgggacg catcgccacg accctgatgc tggtctatcc gccgggtatc      2160
     ggcacggtgc tgccgggcga gcgcctggac gagcgcgcca agcccatgct cgactacttc      2220
     acgatgttcg agacctcggc gaacctgttc ccgggcttcg aggccgagat ccagggcgtc      2280
     taccggcagg tggagccgga cgggcggatc cggttctaca cctatgtcct gcgcgagggc      2340
     gcgggaacga ctgcgcggtg a                                                2361
//

If you have problems or comments...

PBIL Back to PBIL home page