(data stored in ACNUC7421 zone)

EMBL: CP001349.PE279

CP001349.PE279       Location/Qualifiers
FT   CDS_pept        complement(322083..325568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0287"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: met:M446_2324 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55331"
FT                   /db_xref="GOA:B8I9S8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S8"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ACL55331.1"
FT                   /translation="MGRQSAVSSLRPVSLEDKYDLSREQVFITGTQAVIRMLLMQQARD
FT                   RAAGLNTAGFVSGYRGSPIAGLDLNLYKARKVLEAANIVFQPGLNEELAATAIWGAQQA
FT                   EIRGEGRYDGVFGLWYGKGPGVDRAGDVFRHANTAGSSRYGGVLALMGDDHTAESSTLA
FT                   HQSEFHFVDVMMPILNPAGVQEILDYGLYGYAMSRYCGTWVAFKCVKDNIESTASVDAR
FT                   LDRVRIVQPDDFAMPPGGLNIRTPDVILEQEARLQDYKRDAMMAFVRANNLNRIILSGG
FT                   RQPKIGVITVGKSYLDVRQALDDLGLDEVKANDMGLRLYKVACPWPLSQRELLAFAEGL
FT                   DLIMVVEEKRSLIEVQVREELYGTANQPICVGKRDEAGRWLFPVKGALDPNDIAVALGE
FT                   RLLRYHRNDDLAGRVAALRQAQEILAATTDIAVRTPHFCAGCPHNSSTRIPEGARAYAG
FT                   IGCHYMAQWMERGTDGCTQMGGEGANWIGEAPFSKRTHVFQNLGDGTYNHSGSLALRWA
FT                   VDTGTTITYKILFNDAVAMTGGQPHEGGLTVDRIAQQVRAEGVERIALVTDEPHKYPSG
FT                   MRWPEGLTIHHRDDLDTVQRDLATVPGVSVLIYDQTCAAEKRRRRKRGRFPDPDKRVII
FT                   NDLVCEGCGDCSVQSNCVAVQPLETEFGRKRRIDQSSCNKDFSCLNGFCPSFVTVHGGK
FT                   PRTHPLVPLPGTPDEGLPEPVLPPIEGTYNIIVTGVGGTGVVTVGAILGMAAHLEGKGL
FT                   GMIDMAGLAQKGGAVFSHVRLAQAQDDIHAIRVTAGAADLILGCDLVVTGTRKVLAAVR
FT                   PGRTHVVVNTAEIMPGDFTRRPDFSLPVERIKRVIREKAGPAHADLTDATGLAVAALGN
FT                   AIAANMFMLGYAWQRGRVPLSRAAILKAIELNREAVPMNLAAFAWGRRAAAAPETLGAL
FT                   KAATASDLSADLDTLIARRVAFLTDYQDAAYAQRYARIVASVREREAAVHPGGSPLTEA
FT                   VARSLFKLMAYKDEYEVARLYTDGHFEAQIRNTFEGEGLRYEFHLAPPLLARTDPRTGR
FT                   PRKMSFGPWVLRVFRMLARMKRLRGTALDPFGYTQERREERRLIGEFETLVAEILRDLT
FT                   PANHAVAVGLANLPLTIRGFGPVKAKSLAAAKQEEAVLLTRFRAPEAPLAAAAE"
     atgggcaggc agtcggccgt ctcgtccctt cgacccgtca gcctcgagga caagtacgat        60
     ctgtcccgtg aacaggtctt catcaccggc acccaggcgg tgatccggat gctgctgatg       120
     cagcaggccc gcgaccgggc cgccgggctc aacactgcag gcttcgtctc gggctaccgc       180
     ggctcgccga tcgccgggct cgacctgaac ctgtacaagg cccggaaggt gctggaggcg       240
     gccaacatcg tcttccagcc ggggctcaac gaggaactcg ccgccaccgc gatctggggc       300
     gcccagcagg ccgagatccg cggcgagggg cgctacgacg gcgtgttcgg cctctggtac       360
     ggcaaggggc cgggcgtcga ccgcgcgggc gacgtcttcc gtcacgccaa cacggccgga       420
     tcctcccgct acggcggcgt gctggcgctg atgggcgacg accataccgc cgaatcctcc       480
     acgctcgccc accagtccga gttccacttc gtcgacgtga tgatgccgat cctgaacccg       540
     gccggggtgc aggagatcct cgactacggc ctctacggct acgccatgag ccgctattgc       600
     ggcacctggg tcgccttcaa atgcgtgaag gacaacatcg aatcgacggc gagcgtcgat       660
     gcccggctcg accgcgtgag gatcgtgcag ccggacgatt tcgcgatgcc gccgggcggc       720
     ctcaacatcc gcacgccgga cgtgatcctg gagcaggagg cccgcctcca ggactacaag       780
     cgcgacgcga tgatggcctt cgtgcgggcc aacaacctca accgcatcat cctgtcgggc       840
     gggcgccagc cgaagatcgg cgtcatcacg gtcggcaagt cctatctcga tgtccgccag       900
     gccctcgacg atctcggcct cgacgaggtg aaggcgaacg acatggggct tcggctctac       960
     aaggtcgcct gcccgtggcc gctctcgcag cgcgaactcc tcgccttcgc ggaggggctc      1020
     gacctgatca tggtggtcga ggagaagcgc tccctcatcg aggtgcaggt ccgcgaggag      1080
     ctctacggca ccgccaacca gccgatctgc gtcggcaagc gcgacgaggc ggggcgctgg      1140
     ctcttccccg tcaagggagc gctcgacccc aacgacatcg cggtggcgct gggcgagcgc      1200
     ctgctgcgct accatcgcaa cgacgatctg gcggggcgcg tcgccgccct ccggcaggcg      1260
     caggagatcc tcgcggccac gaccgacatc gcggtccgca cgccccattt ctgcgccggc      1320
     tgcccgcaca acagctcgac ccggattccc gagggagcgc gggcctatgc ggggatcggc      1380
     tgccactaca tggcccagtg gatggagcgc ggcaccgacg gctgcaccca gatgggcggc      1440
     gagggcgcga actggatcgg cgaggcgccg ttctcgaagc gcacccacgt gttccagaat      1500
     ctcggcgacg gcacctacaa ccattccggc tcgctggccc tgcgctgggc cgtcgatacc      1560
     ggcaccacca tcacctacaa gatcctgttc aacgatgcgg tggcgatgac gggcggccag      1620
     ccccacgagg gcggcctcac cgtcgaccgc atcgcccagc aggtccgcgc cgagggcgtc      1680
     gagcggatcg cgctcgtcac ggacgagccc cacaagtacc cgtccgggat gcgctggccg      1740
     gagggtctga cgatccacca ccgggacgac ctcgatacgg tccagcgcga cctcgcgacg      1800
     gtgccgggcg tctcggtgct gatctacgac cagacctgcg ctgccgagaa gcggcggcgc      1860
     cgcaagcgcg gccggttccc cgaccccgac aagcgggtga tcatcaacga tctcgtctgc      1920
     gagggctgcg gcgactgctc ggtgcagtcg aactgcgtgg cggtgcagcc gctggagacc      1980
     gagttcggcc gcaagcgccg catcgaccag tcgagctgca acaaggattt ttcctgcctc      2040
     aacggcttct gcccgtcctt cgtcaccgtg cacgggggaa aaccgcgcac gcacccgctg      2100
     gtgccgctcc cgggcacgcc ggacgagggc ctgccggagc cggtcctgcc ccccatcgag      2160
     ggcacctaca acatcatcgt gacgggcgtc ggcggcaccg gcgtggtcac ggtcggggcg      2220
     atcctcggca tggcggccca tctcgaaggc aaggggctcg gcatgatcga catggcgggc      2280
     ctcgcccaga agggcggggc ggtgttcagc catgtccgtt tggctcaagc ccaggacgac      2340
     atccatgcga tccgggtcac ggcgggcgcc gccgacctga tcctcggctg cgacctcgtc      2400
     gtgaccggga cccgcaaggt gctcgccgcc gtgcggcccg gccgcaccca tgtggtcgtc      2460
     aacaccgccg agatcatgcc gggcgacttc acccgccggc ccgacttctc gctcccggtg      2520
     gagcgcatca agcgggtgat ccgcgagaag gccggcccgg cccatgcgga cctcaccgat      2580
     gccaccgggc tcgcggtggc ggcgctcggc aatgccatcg cggccaacat gttcatgctg      2640
     ggttatgcgt ggcagcgcgg tcgcgtgccg ctgtcgcggg ccgcgatcct gaaggcgatc      2700
     gagctcaacc gcgaggcggt gccgatgaac ctcgcggcct tcgcctgggg ccggcgggcc      2760
     gccgccgcgc ccgagaccct gggcgcgctc aaggccgcga cggcctcgga tctctcagcc      2820
     gatctcgaca cgctgatcgc ccggcgcgtc gccttcctga ccgactacca ggacgcggcc      2880
     tatgcgcagc gctatgcccg catcgtcgcc tccgtgcggg agcgggaggc tgcggtgcat      2940
     ccgggcggaa gcccgctcac cgaggcggtg gcacggtccc tgttcaagct gatggcctac      3000
     aaggacgagt acgaggtggc ccgcctctat acggacgggc atttcgaggc gcagatccgc      3060
     aacaccttcg agggcgaggg gctgcgctac gagttccacc tcgcgccgcc gctcctcgcg      3120
     cgcaccgatc cccggaccgg gcgcccgcgc aagatgagct tcggcccctg ggtgctgcgc      3180
     gtcttccgga tgctcgcccg gatgaagcgg ttgcgcggca cggccctcga cccgttcggc      3240
     tacacgcagg agcgccggga ggagcgccgc ctcatcggcg aattcgagac gctcgtcgcc      3300
     gagatcctgc gcgacctgac cccggcgaac cacgcggtcg cggtcggcct cgcgaacctg      3360
     cccctgacca tccggggctt cgggccggtc aaggcgaaga gcctcgccgc cgccaagcag      3420
     gaggaggcgg tgctgctcac gcggttccgc gcgccggagg cgccgctggc cgcggctgcg      3480
     gagtga                                                                 3486
//

If you have problems or comments...

PBIL Back to PBIL home page