(data stored in ACNUC7421 zone)

EMBL: CP001349.PE28

CP001349.PE28        Location/Qualifiers
FT   CDS_pept        complement(29335..29595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0029"
FT                   /product="putative signal peptide"
FT                   /note="KEGG: met:M446_0026 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55080"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT18"
FT                   /inference="similar to AA sequence:KEGG:M446_0026"
FT                   /protein_id="ACL55080.1"
FT                   /translation="MFEVWVESVLLAVESQSVIARRLVKLAACDAAAAAEAHQMVSEKV
FT                   GALIEASGTLLAGGSMGAVLARYREHVAANAARLALPPPAE"
     atgttcgaag tgtgggttga gtccgtcctg ctggcggtgg agtcgcagag cgtgatcgcg        60
     cgacgtctgg tgaagctcgc tgcctgcgat gccgccgccg ccgcagaggc gcaccagatg       120
     gtgagcgaga aggtgggtgc cctcatcgag gcatccggca cgctgctcgc gggcggcagc       180
     atgggcgccg tgctggcgcg ctaccgcgag cacgtcgccg ccaacgccgc gcggctcgcc       240
     ctgccgcccc ccgccgagtg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page