(data stored in ACNUC7421 zone)

EMBL: CP001349.PE280

CP001349.PE280       Location/Qualifiers
FT   CDS_pept        complement(325792..327486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0288"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_2319 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55332"
FT                   /db_xref="GOA:B8I9S9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55332.1"
FT                   /translation="MTHPRASYVHGACEVPLLGRTIGQALSAAAEAWPDHPALIAPAGE
FT                   VRWSWAELNARAEAFAAGLLALGLERGDRIGIWSLNNAEWALTQFAAAKAGLILVTVNP
FT                   AYRLAELEFALNKVGCKALVTARAFKSSDYIGMLTSLAPELREAAPGRLRAARLPALRT
FT                   VIEIGGGESPGTLPFAAVAERAGATERDRISAHAGALQFDDPVNIQFTSGTTGSPKGVT
FT                   LTHHNILNNGYFVGRAMRLSPEDRICIPVPLYHCFGMVMGNLAAVSSGAAMVYPGEGFD
FT                   PLATLRAVEAERCTALYGVPTMFLAELDHPDFARFDLSSLRTGIMAGSPCPIAVMQRAV
FT                   DRMHLTQLTICYGMTETSPVSFQSAVDDPLERRVSTVGRIHPHTEVKVVDAEGRIVPRG
FT                   TPGELCTRGYSVMQGYWGDPEKTAEVRDAAGWMHTGDLATLDEDGFCNIVGRIKDLVIR
FT                   GGENVYPREVEEFLYRHPAIQEVQVFGVPDPRYGEELCAWVRLRPGAALTAEGLRAHCA
FT                   GQIAHQKIPRYVEFVEEFPTTVTGKMQKYRMRQAMVEKLGLVAEKTA"
     atgacccacc ctcgggcgag ctacgtccat ggcgcctgcg aggtcccgct cctcggccgg        60
     accatcggcc aggcgctgag cgcggccgcg gaagcatggc ccgaccaccc ggccctgatc       120
     gcgccggccg gcgaagtgcg ctggagctgg gccgagctga acgcgcgggc cgaggctttc       180
     gcggcgggtc tcctggcgct cgggctcgag cggggcgacc ggatcgggat ctggtcgctc       240
     aacaacgccg aatgggcgct cacccagttc gccgccgcca aggccgggct gatcctcgtc       300
     acggtcaatc cggcctaccg gctggcggag ctcgaattcg cgctcaacaa ggtcgggtgc       360
     aaggccctcg tcaccgcccg cgccttcaag agcagcgatt atatcggcat gctgacgtcg       420
     cttgcccccg agctgcgcga ggcggcgccg gggcgcctgc gggccgcgcg gctcccggcg       480
     cttcgcaccg tgatcgagat cggcggcggg gaatcgccgg gcacgctgcc cttcgcggcc       540
     gtggcggagc gggcgggcgc gaccgagcgc gaccgcatct ccgcccatgc cggcgcgctg       600
     cagttcgacg atccggtcaa catccagttc acgagcggga caaccggcag tccgaagggc       660
     gtgaccctca cccaccacaa catcctcaac aacggctatt tcgtcggccg cgccatgcgc       720
     ctgtcgccgg aggaccggat ctgcattccg gtgccgctct atcactgctt cggcatggtg       780
     atgggcaatc tcgcggcggt gagttcgggc gccgccatgg tctatccggg cgagggcttc       840
     gatcccctgg cgacgctgcg cgccgtcgag gcagagcgct gcacggcgct ctacggcgtg       900
     ccgaccatgt tcctcgccga gctcgaccac ccggatttcg cgcgcttcga cctgtcgagc       960
     ctgcgcaccg gcatcatggc gggctcgccc tgtccgatcg ccgtgatgca gcgggcggtc      1020
     gaccggatgc atctcacgca gctgacgatc tgctacggca tgaccgagac gagcccggtg      1080
     agcttccaga gcgcggtgga cgatcccctg gagcggcgcg tctcgacggt ggggcgcatc      1140
     cacccgcaca ccgaggtgaa ggtcgtcgac gccgagggcc gcatcgtgcc gcggggcacg      1200
     cccggggagc tgtgcacgcg gggctacagc gtgatgcagg gctactgggg cgatcccgag      1260
     aagacggccg aggtgcgcga cgccgccggc tggatgcata cgggcgacct cgccaccctc      1320
     gacgaggatg gcttctgcaa catcgtcggg cgcatcaagg atctcgtcat ccgcggcggc      1380
     gagaacgtct atccgcgcga ggtggaggaa ttcctctacc gccatccggc gatccaggag      1440
     gtgcaggtct tcggcgtgcc cgatccccgc tacggcgagg aactctgcgc ctgggtcagg      1500
     ctgcgcccgg gcgcggcgct gacggcggag ggcttgcgcg cccactgcgc cggccagatc      1560
     gcccatcaga agatcccccg ctacgtcgag ttcgtggagg agttccccac gaccgtgacg      1620
     ggcaagatgc agaagtatcg gatgcggcag gcgatggtgg agaagctggg actggtcgcg      1680
     gagaagacgg cttag                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page