(data stored in ACNUC7421 zone)

EMBL: CP001349.PE281

CP001349.PE281       Location/Qualifiers
FT   CDS_pept        327664..328839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0289"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: met:M446_2318
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55333"
FT                   /db_xref="GOA:B8IAU0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU0"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACL55333.1"
FT                   /translation="MIPNAAREFNFGLGETADAIRESVRDFARDRIAPRAEEIDRTNTF
FT                   PRDLWPEMGALGLHGITVEEEYGGLGLGYLEHCVAMEEVSRASASVGLSYGAHSNLCIN
FT                   QIRRNGSDAQKRRYLPKLISGDEVGALAMSEPGSGSDVVSMRTRAEKRGDRYVLTGSKM
FT                   WITNGPEAETLVVYAKTDPAAGPRGITAFLIEKGMKGFSTAQKLDKLGMRGSDTCELVF
FT                   EECEVPEENVLGEVGRGVNVLMSGLDYERAVLAAGPLGIMQACLDVVLPYVHERKQFGQ
FT                   PIGEFQLVQGKLADMYVATNAAKAYVYAVAQACDRGETTREDAAGAILYAAERATQCAL
FT                   DAIQLLGGNGYINDYPTGRLLRDAKLYEIGAGTSEIRRMLIGRELFAKSSA"
     atgatcccga acgccgcacg cgagttcaat ttcggcctcg gcgagacggc cgacgcgatc        60
     cgcgagagcg tgcgcgactt cgcgcgggac cggatcgcgc cgcgggccga ggagatcgac       120
     cgcaccaaca ccttcccgcg cgacctctgg cccgagatgg gggcgctcgg cctccacggg       180
     atcacggtcg aggaggagta tggcggcctc ggcctcggct atctggagca ttgcgtggcc       240
     atggaggagg tgtcgcgcgc ctccgcctcg gtcggcctgt cctacggggc gcattcgaac       300
     ctctgcatca accagatccg ccgcaacggc tcggacgcgc agaagcgccg ctacctgccc       360
     aagctcatct ccggcgatga ggtcggcgcg ctcgccatgt cggagccggg ctccggttcg       420
     gacgtggtct cgatgcgcac ccgcgccgag aagcgcggcg accgctatgt gctcaccggc       480
     tccaagatgt ggatcaccaa cggcccggag gccgagacgc tggtggtcta tgccaagacc       540
     gacccggccg cggggccgcg ggggatcacc gccttcctca tcgagaaggg catgaagggc       600
     ttctccaccg cccagaagct cgacaagctc ggcatgcggg gctcggacac ctgcgagctc       660
     gtgttcgagg aatgcgaggt gccggaggag aacgtgctcg gcgaggtcgg gcgcggcgtg       720
     aacgtcctga tgtcgggcct cgactacgag cgcgccgtgc tggcggcggg gccgctcggc       780
     atcatgcagg cctgcctcga cgtggtcctg ccctatgtcc acgaacgcaa gcagttcggc       840
     cagccgatcg gcgagttcca gctcgtccag ggcaagctcg ccgacatgta cgtggccacc       900
     aacgccgcca aggcctatgt ctacgccgtg gcgcaggcct gcgaccgggg cgagaccacc       960
     cgtgaggacg cggcgggcgc gatcctctac gcggccgagc gggcgacgca atgcgccctc      1020
     gacgcgatcc agctcctcgg cggcaacggc tacatcaacg actacccgac cgggcgcctg      1080
     ttgcgcgacg ccaagctcta cgagatcggc gcgggcacga gcgagatccg ccgcatgctg      1140
     atcggccgcg agctcttcgc gaaatcctcg gcttga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page