(data stored in ACNUC7421 zone)

EMBL: CP001349.PE282

CP001349.PE282       Location/Qualifiers
FT   CDS_pept        328849..330456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0290"
FT                   /product="carboxyl transferase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: met:M446_2317
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55334"
FT                   /db_xref="GOA:B8IAU1"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU1"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACL55334.1"
FT                   /translation="MPVLPTTADLASAEAGRNRAAWSELRTTLKARRAEAAAGGPPRAR
FT                   ERHRARGKLLPRDRVLRLLDPGSPFLEIGALAAYGMYDDAIHAAGLIAGIGRVAGREVM
FT                   IVCNDATIKGGTYFPVTVKKHLRAQEIARENRLPCLYLVDSGGANLPQQTEVFPDREHF
FT                   GRIFYNQAQLSAAGIPQIACVMGSCTAGGAYVPAMSDESVIVRRQGTIFLGGPPLVKAA
FT                   TGEVVSAEDLGGADVHARLSGVADHYATDDAHALAILRRIVGTLNSVKRPDLDLTASCD
FT                   PLHDAADLDAVVPVDLRKQYDSREIIARLVDGSEFDEFKRLYGTTLVTGFARLWGMPVG
FT                   ILANNGILYSESALKGAHFIELCCQRRVPLLFLQNIAGFMVGREVEAGGIARNGAKLVT
FT                   AVATAAVPKLTVLVGGSYGAGNYGMCGRAYGPRFLFAWPNSRISVMGAEQAASVLATVR
FT                   RDNLEAAGETWSAEEEEAFKAPIREQFEAEGSPYYATARLWDDGIILPEETRRVLGLAL
FT                   SACLNAPVPETRFGLFRM"
     atgccggtcc tgccgaccac cgccgatctc gcctccgcgg aggccggacg caaccgcgcc        60
     gcctggtcag agctgcgcac caccctgaag gcgcgccgcg ccgaggccgc ggccggcggt       120
     ccgccgcggg cgcgcgagcg ccaccgcgcc cgcggcaagc tcctgccccg cgaccgggtg       180
     ctgcgcctcc tcgatccggg ctcgcccttc ctggagatcg gcgcgctcgc agcctacggg       240
     atgtacgacg acgcgatcca cgcggccggc ctgatcgccg gcatcggacg ggtcgcgggc       300
     cgggaggtca tgatcgtctg caacgacgcg acgatcaaag gcggcaccta tttcccggtc       360
     acggtgaaga agcacctgcg cgcgcaggag atcgcccgcg agaaccgcct gccctgcctc       420
     tacctggtgg attcgggcgg cgccaacctg ccccagcaga ccgaggtgtt tcccgaccgc       480
     gagcatttcg ggcgcatctt ctacaaccag gcccagctct cggcggcggg catcccgcag       540
     atcgcctgcg tgatgggctc ctgcacggcg ggcggcgcct acgtgcccgc catgtcggac       600
     gaaagcgtga tcgtgcgccg ccagggcacg atcttcctcg gcggcccgcc tctcgtgaag       660
     gcggcgaccg gcgaggtcgt cagcgccgag gatctcggcg gggccgacgt gcatgcccgg       720
     ctctcgggcg ttgccgacca ctacgccacc gatgacgcgc atgccctggc gatcctgcgc       780
     cgcatcgtcg gcacgctgaa cagcgtcaag cggcccgacc tcgacctcac agcctcgtgc       840
     gatccgctcc acgatgccgc cgacctcgac gccgtggtgc cggtcgacct gcgcaagcag       900
     tacgattccc gcgagatcat cgcccggctc gtcgacggct ccgagttcga cgagttcaag       960
     cggctctacg gcaccacgct ggtgacgggc ttcgcccgcc tgtggggcat gccggtcggg      1020
     atcctggcga ataacggcat cctctactcg gagagcgcgc tcaagggcgc gcatttcatc      1080
     gagctgtgct gccagcgccg ggtgccgctc ctgttcctcc agaacatcgc cggcttcatg      1140
     gtcgggcgcg aggtggaagc cggcggcatc gccaggaacg gcgccaagct ggtgaccgcc      1200
     gtcgcgaccg cggcggtgcc gaagctgacc gttctggtcg gcggctctta cggcgcgggc      1260
     aattacggca tgtgcgggcg cgcctacggc ccgcgcttcc tgttcgcgtg gccgaactcg      1320
     cgcatctcgg tgatgggcgc cgagcaggcc gcgagcgtgc tcgccaccgt gcgccgcgac      1380
     aacctcgaag ccgccggcga gacctggagc gccgaggagg aggaggcttt caaggccccg      1440
     atccgcgagc agttcgaggc cgagggctcg ccctattacg ccaccgcgcg gctgtgggac      1500
     gacggcatca tcctgccgga ggaaacccgc cgggtgctcg ggctcgccct ctcggcctgc      1560
     ctcaacgcgc cggtgccgga gacgcggttc gggctgttcc ggatgtga                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page