(data stored in ACNUC7421 zone)

EMBL: CP001349.PE283

CP001349.PE283       Location/Qualifiers
FT   CDS_pept        330749..332698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0291"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   met:M446_2316 carbamoyl-phosphate synthase L chain
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55335"
FT                   /db_xref="GOA:B8IAU2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU2"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACL55335.1"
FT                   /translation="MTGLRSVLIANRGEIACRVIRTAKRLGLRTIAVHSEADRSALHVA
FT                   MADEAHLIGPAPAAESYLRIDRILEAAAQAGADCIHPGYGFLSERPDFAEACAAAGLVF
FT                   VGPPAPAICAMGLKDAAKALVAKAGVPVVPGYHGARQEPDFLAAEAAAIGYPVLIKAVA
FT                   GGGGKGMRRVERSEDFAAALEGAQREALAAFGDPRVLVEKYVLAPRHVEIQVFCDAHGH
FT                   AVHLFERDCSLQRRHQKVIEEAPAPGMSPAVRAAMGRAAVEAARAVGYVGAGTVEFIAD
FT                   GREGLTTDGFWFMEMNTRLQVEHPVTEAITGVDLVEWQFRVAAGEPLPCGQDDLAIRGH
FT                   AVEARLYAEDPAADFLPSTGRLRALDLPTGDGIRVDTGVRAGDLVSPFYDPMIAKVIAH
FT                   GETRGQALDRLAQALERTLVAGPRANVAFLKALAEAEEFRAGRFDTGFIDRHLDALTGR
FT                   AAGIDPEAIRQGVAALIARAQGVPGAPTSPWEVADGFQLGAGRRQAWPVLVEGEARAVT
FT                   LAWPEGGGAMAIEAGEAARAPRPRPRGADRTRHARRGGRPAGGGGAARSLRCRSRPHRY
FT                   GRERQGTDAWPPRRHPRRPGRAGDARPAPRHRRGDEDGARPHRPRRRRGHGGGGGGRRA
FT                   GCRGRAPDHHPHGG"
     atgaccgggc tccgctccgt cctgatcgcc aaccggggcg agatcgcctg ccgggtgatc        60
     cgcaccgcca agcggctcgg cctgcgcacc atcgcggtcc attccgaggc ggatcgctcc       120
     gccctgcacg tcgccatggc cgacgaggcg catctcatcg gcccggcgcc ggccgccgaa       180
     tcctatctgc gcatcgaccg catcctcgag gcggcggcgc aggccggcgc cgactgcatc       240
     catccgggct acggcttcct gtccgagcgc cccgacttcg ccgaggcctg cgcggcggcc       300
     gggctcgtct tcgtcgggcc gccggccccg gcgatctgcg ccatgggcct caaggacgcc       360
     gccaaggccc tggtcgccaa ggccggcgtg ccggtggtgc cgggctacca cggtgcccgc       420
     caggagcccg acttcctcgc cgccgaggcc gcggcgatcg gctatccggt cctcatcaag       480
     gcggtggccg gcggcggcgg caagggcatg cggcgggtcg agcgctcgga ggatttcgcc       540
     gccgccctcg aaggcgcgca acgcgaggcg ctggccgcct tcggcgatcc gcgggtgctg       600
     gtggagaaat acgtcctcgc cccgcgccac gtggagatcc aggtcttctg cgacgcgcat       660
     ggccatgccg tgcacctgtt cgagcgcgac tgctcgctcc agcgccgcca ccagaaggtg       720
     atcgaggagg cgcccgcccc gggcatgtcg ccggcggtcc gcgccgccat gggccgggcc       780
     gccgtcgagg cggcacgggc ggtcggctat gtcggcgccg gcaccgtcga gttcatcgcc       840
     gacggccgcg agggcctcac gaccgacggc ttctggttca tggagatgaa cacgcggctg       900
     caggtcgagc acccggtcac cgaggcgatc accggggtcg atctggtgga atggcagttc       960
     cgggtggcgg cgggcgagcc cctgccatgc ggtcaggacg acctcgccat ccgcgggcac      1020
     gccgtcgagg cgcggctcta cgcggaggat ccggcggcgg atttcctgcc ctcgaccggg      1080
     cggctgcgcg ccctcgactt gccgacgggc gacggaatcc gcgtcgatac cggcgtgcgc      1140
     gcgggcgatc tggtctcgcc cttctacgat ccgatgatcg ccaaggtcat tgcccacggg      1200
     gagacgcggg ggcaggccct cgaccggctg gcgcaggctc tcgagcgcac cctcgtcgcc      1260
     ggcccccgag cgaacgtcgc cttcctcaag gcgctggccg aggcggagga gttccgggcc      1320
     gggcgcttcg acaccggctt catcgaccgc catctcgatg cgctcaccgg ccgcgccgcc      1380
     gggatcgatc ccgaggcgat ccggcagggc gtcgccgccc tgatcgcccg cgcgcaaggg      1440
     gtgccgggtg cccccacctc gccctgggag gtcgcggacg ggttccagct cggggccggg      1500
     cgccggcagg cctggcccgt cctcgtcgag ggcgaggccc gcgcggtgac gctggcctgg      1560
     cccgagggcg gcggggccat ggcgatcgag gccggcgaag cggcccgcgc cccccgcccc      1620
     cgtccacgtg gtgccgaccg aacgcggcat gctcgtcgtg gcgggcggcc ggcaggtggc      1680
     ggtggagccg cccgatccct tcgatgtcga tctcgaccac atcgatatgg gcgggagcgt      1740
     caaggcaccg atgcatggcc gcctcgtcgc catcctcgtc gccccgggcg agcgggtgac      1800
     gcgcggccag cgcctcgcca tcgtcgaggc gatgaagatg gagcacgccc tcaccgcccc      1860
     cgccgacggc gaggtcacgg aggtggcggc ggaggccggc gcgcaggttg ccgagggcgc      1920
     gcgcctgatc accatccgca cggaggatga                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page