(data stored in ACNUC7421 zone)

EMBL: CP001349.PE284

CP001349.PE284       Location/Qualifiers
FT   CDS_pept        332702..333202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0292"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   met:M446_2315 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55336"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU3"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55336.1"
FT                   /translation="MTNPLPVSTHPRGGLYFEDFEVGRVLRHRLTRTVTQMDNMLFSTM
FT                   TLNPQPLHIDAHFCATETEWGRPLMNSLFTLGLMIGISVNDTTVGTTIGNLGMTDVRFP
FT                   APLFEGDTIRVETEVAGKRESRSRPNAGLVEFIHRAYKQDGTLVAECRRQALMRRHPPA
FT                   ETA"
     atgacgaacc cgcttcccgt ctccacccat ccccgcggcg gcctctattt cgaggatttc        60
     gaggtcggac gcgtgctgcg ccatcggctc acccgcacgg tgacgcagat ggacaacatg       120
     ctgttctcca ccatgaccct caatccgcag ccgctccata tcgacgcgca tttctgcgcg       180
     accgagaccg agtggggccg gccgctgatg aactcgctct tcaccctcgg gctgatgatc       240
     gggatctccg tcaacgacac tacggtcggc accacgatcg gcaatctcgg catgacggat       300
     gtgcgcttcc ccgcgcccct gttcgagggc gacacgatcc gggtcgagac cgaggtggcg       360
     ggcaagcgcg agtcgcgctc gcggcccaat gccgggctcg tcgagttcat ccaccgggcc       420
     tacaagcagg acgggacgct ggtcgccgaa tgccgccggc aggccctcat gcggcggcat       480
     ccccccgcag agacggcctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page