(data stored in ACNUC7421 zone)

EMBL: CP001349.PE285

CP001349.PE285       Location/Qualifiers
FT   CDS_pept        333202..334077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0293"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: met:M446_2314
FT                   citrate (pro-3S)-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55337"
FT                   /db_xref="GOA:B8IAU4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU4"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ACL55337.1"
FT                   /translation="MRSLLFVPGDSARKLDKALDSGADALILDLEDSVAMAEKPAARAA
FT                   TAGFLARARDLPARPRLYVRINALETGLADDDLAAVMPASPDGIVLPKAAGGPDVAALG
FT                   ARLAVHEAEAGLADCATRILPIATETAQAVFALGTLAGSSPRLAGVTWGAEDLSADLGA
FT                   ETNRGEDGGWSAPFRLARNLALLAAAAAEVDAIDTINAAFRDLDGLARECREARRDGFV
FT                   GKMAIHPAQVPVINAAFTPSEAELARARAVVAAFAQAPGTGVVGVEGQMLDRPHLRRAE
FT                   RLLARVGGGV"
     atgcgctcgc tcctgttcgt gccgggcgat tcggcccgca agctcgacaa ggcgctggat        60
     tccggtgccg atgccctgat cctcgatctg gaggattcgg tggcaatggc cgagaagccg       120
     gcggcgcggg ccgccacggc gggtttcctt gcccgcgcgc gcgatctgcc cgcccgcccg       180
     cgcctctatg tgcgcatcaa cgccctggag accggccttg ccgacgacga tctcgcggcc       240
     gtgatgccgg cttctccaga cgggatcgtg ctgccgaagg cggcgggcgg ccccgacgtg       300
     gcggcgcttg gtgcccggct cgccgtgcac gaggccgagg cgggccttgc cgactgcgcg       360
     acccgcattc tgccgatcgc caccgagacc gcacaggcgg tcttcgcgct cggcacgctc       420
     gcgggatcga gcccgcggct cgccggggtg acctggggcg cggaggatct ctcggccgat       480
     ctcggggcgg agacgaaccg gggcgaggac ggcggctgga gtgccccgtt ccggctcgcc       540
     cgcaacctcg ccctgctcgc cgccgccgcc gccgaggtcg acgcgatcga tacgatcaat       600
     gcggccttcc gcgacctcga cggcctcgcc cgcgagtgcc gcgaagcccg gcgggacggc       660
     ttcgtcggca agatggcgat ccatccggcg caggtgccgg tgatcaacgc cgccttcacg       720
     ccctcggagg cggaactcgc ccgggcgcgg gccgtggtgg ccgccttcgc gcaggcgccc       780
     ggcaccggcg tggtcggggt cgagggccag atgctcgacc ggccgcatct gcggcgggcg       840
     gagcggctgc tggcacgggt gggtggaggc gtgtga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page