(data stored in ACNUC7421 zone)

EMBL: CP001349.PE286

CP001349.PE286       Location/Qualifiers
FT   CDS_pept        334144..335376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0294"
FT                   /product="putative phenylacetate-CoA ligase"
FT                   /note="KEGG: met:M446_2311 putative phenylacetate-CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55338"
FT                   /db_xref="GOA:B8IAU5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU5"
FT                   /inference="similar to AA sequence:KEGG:M446_2311"
FT                   /protein_id="ACL55338.1"
FT                   /translation="MPEHYDARETESPAARDAALFARLPDILAAALRSPGYAAHLGEID
FT                   PAAITDRTALARLPVLRKSEMPEKQRGALPFGGFVPGEPGRFPRLFTSPGPIFEPQRSG
FT                   EDPWGGARCLFAAGFRPGDVVLNTFGYHLTPGGFIFDTAARALGCAVIPAGPGNTEQQL
FT                   DLIEAYRPTGYCGTPDFLRILVEAGRAAGRNISSLRRSVVSGAAFPKSLQEIVAGFGIA
FT                   AYQAYATADVGFIAYETSARDGLVVNEDLILEIVRPGTGDPVPEGEVGEIVVTVLDPDR
FT                   PLIRYALGDLTAALGHASSCGRTAPRIRGWMGRADQAAKVKGMFVRPEQVAELARRHPE
FT                   LKRLRLVVTRADETDAMTLKAETAEPGRALADAVAESLQAVTKLRGAVELVAPGSLPND
FT                   GKVIADERPTG"
     gtgcccgaac actacgacgc ccgcgagacc gagagcccgg ccgcccgcga cgcggccctg        60
     ttcgcccgcc tgccggatat tctcgccgcc gccctgcgca gccccggcta cgcggcccat       120
     ctcggggaga tcgacccggc cgccatcacc gatcgcacgg cgctggcccg cctgcccgtg       180
     ctgcgcaaga gcgagatgcc ggagaagcag cggggcgccc tcccgttcgg cggattcgtg       240
     ccgggagagc ccgggcgctt cccccggctc ttcacctcgc cggggccgat cttcgagccg       300
     cagcgctccg gcgaggatcc ctggggcggg gcgcgctgcc tgttcgcggc ggggttcagg       360
     ccgggcgacg tggtgctgaa caccttcggc tatcacctga ccccgggcgg cttcatcttc       420
     gacacggcgg cccgggccct cggctgcgcg gtgatcccgg ccggccccgg caacaccgag       480
     cagcagctcg acctgatcga ggcctaccgg cccaccggct attgcggcac gccggatttt       540
     ctgcggatcc tggtcgaggc cggccgcgcc gccggccgaa atatctcctc gctccggcgc       600
     tccgtcgtct cgggcgcggc cttcccgaaa tccctgcagg agatcgtggc cggcttcggc       660
     atcgcggcct atcaggccta cgccacggcc gatgtgggct tcatcgccta cgagacctcc       720
     gcccgcgacg ggctcgtggt caacgaggac ctgatcctgg agatcgtgcg gcccggcacg       780
     ggcgacccgg tgcccgaggg cgaggtcggc gagatcgtgg tcacggtcct cgatccggac       840
     cggccgctga tccgctacgc gctcggcgac ctcacggcgg ccttggggca cgcgagttcc       900
     tgcgggcgca ccgccccgcg catccgcggc tggatgggcc gcgccgatca ggccgccaag       960
     gtgaagggga tgttcgtgcg tccagagcag gtggccgagc tggcccgccg ccacccggaa      1020
     ctgaagcgcc tgcgcctcgt cgtgacccgt gccgacgaga ccgacgccat gacgctgaag      1080
     gccgagacgg ccgagcccgg tcgggcgctc gcggatgcgg tcgccgaaag cctgcaggcg      1140
     gtgacgaagc tgcgcggcgc cgtcgagctc gtcgcgcccg gcagcctgcc gaacgacggc      1200
     aaggtcatcg ccgacgagcg cccgaccggc tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page