(data stored in ACNUC7421 zone)

EMBL: CP001349.PE287

CP001349.PE287       Location/Qualifiers
FT   CDS_pept        complement(335348..336010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0295"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: met:M446_2310
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55339"
FT                   /db_xref="GOA:B8IAU6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55339.1"
FT                   /translation="MARIAGSSGPKTEEAIRRAGLQLLYTHGYAAMSLRQLAGAVGIQQ
FT                   GSLYNYFRNKQEFLFELIRSHMRDLHAALDAALLPEGNGVARLTRFVEFHVAYHIERPQ
FT                   EVFICYSELRSLEPENFSAIVAMRRDYEDKLIEILEFGRATGEFRLADTRMAAYAILAM
FT                   LSGICTWYRPGGRLSKDEVRETFLGMVLSLVSGVGMEESLPEPPRLAEVSRSGARRR"
     atggcgcgca tcgcaggctc atccgggccg aagaccgagg aggcgatccg cagggcgggc        60
     ctgcaactcc tctacacgca tggctatgcg gcgatgagcc tgcgccagct cgccggggcg       120
     gtcggcatcc agcagggctc gctctacaac tatttccgca acaagcagga attcctgttc       180
     gagctgatcc gcagccacat gcgggacctg catgcggccc tcgatgcggc cctgcttccg       240
     gaggggaacg gcgtcgcgcg gctgacgcgc ttcgtggagt tccacgtcgc ctatcacatc       300
     gagcggccgc aggaggtctt catctgctac tcggagctgc gtagcctcga gcccgagaat       360
     ttttccgcga tcgtcgccat gcggcgcgac tacgaggaca agctgatcga gatcctcgaa       420
     ttcgggcgcg ccaccggcga gttccgtctc gccgacacca ggatggccgc ctatgccatc       480
     ctggcgatgc tgtcgggcat ctgcacgtgg taccgtccgg gcggacgcct ctcgaaggac       540
     gaggtgcgcg agaccttcct cggcatggtg ctctcgctgg tgagcggggt cgggatggaa       600
     gagagccttc ccgaaccacc gcggctcgcc gaggtcagcc ggtcgggcgc tcgtcggcga       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page