(data stored in ACNUC7421 zone)

EMBL: CP001349.PE288

CP001349.PE288       Location/Qualifiers
FT   CDS_pept        336206..337015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0296"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2309 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55340"
FT                   /db_xref="GOA:B8IAU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55340.1"
FT                   /translation="MAEALEVRHVSLRFGGVKALTDVGFTVEQGELFSIIGPNGAGKTS
FT                   MLNCISGRYRPTEGQILFQGRDITRATPNARPKLGIGRTFQNLALFHHMSVLDNIMVGR
FT                   HHLLRNNFLTGSLYWLPGVRSEELAHRRRVEEIIDFLDLQAYRKATAGTLSYGLRKRVE
FT                   LARAMALEPRLILLDEPMAGMNLEEKEDMARYIVDLNEEFGMTVVMIEHDMGVVMDISH
FT                   RVMVLDFGRRIALGRPEAVLADPHVRRAYLGEEDEAEDAQAPIRAVS"
     gtggcggagg cccttgaggt tcgccatgtc tcgttgcgct tcggcggcgt gaaggccctg        60
     acggatgtcg gcttcaccgt cgagcaaggc gagctgttct cgatcatcgg ccccaacggc       120
     gccggcaaga cctcgatgct gaactgcatc tcgggccgct accggccgac cgaggggcag       180
     atcctgttcc agggccgcga catcacccgg gcgaccccga atgcgcggcc caagctcggc       240
     atcggccgca ccttccagaa cctcgcgctc ttccaccaca tgagcgtgct cgacaacatc       300
     atggtcgggc gccaccatct cctgcgcaac aacttcctga caggctcgct ctactggctg       360
     ccgggcgtgc ggagcgagga gctcgcacat cggcggcgcg tggaggagat catcgacttc       420
     ctcgacctcc aggcctaccg gaaggcgacg gccggcaccc tgtcctacgg gttgcgcaag       480
     cgggtcgagc tcgcccgcgc catggcgctg gaacccaggc tgatcctcct cgacgagccg       540
     atggccggca tgaacctcga ggagaaggag gacatggccc gctacatcgt cgacctgaac       600
     gaggagttcg ggatgacggt ggtgatgatc gagcacgaca tgggcgtggt catggacatc       660
     tcgcaccggg tcatggtgct ggatttcggc cgccgcatcg cgctcgggcg ccccgaggcg       720
     gtgctggccg atccgcatgt ccgccgcgcc tatctgggcg aggaggacga ggccgaggac       780
     gcgcaggctc cgatccgggc ggtgtcgtga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page