(data stored in ACNUC7421 zone)

EMBL: CP001349.PE289

CP001349.PE289       Location/Qualifiers
FT   CDS_pept        337015..338946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0297"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_2308 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55341"
FT                   /db_xref="GOA:B8IAU8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU8"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55341.1"
FT                   /translation="MGTDFAARAAKADTFPKLLALNAREHPHAVALREKDLGLWRPTTW
FT                   SQYQDRVRAFALGLRDLGIGEGDVVGLIGDNRPDWVAGEIAAHALGALTLGLYRDALED
FT                   EVHYLLDYGEARVVFAEDEEQVDKLIGLADRVPSLRHIVYSDPRGMRKYDDRRLISAEA
FT                   LARRGAALEAAEPGLYERLVEATDGEAVAILCTTSGTTARPKLAMLSAGRVLRHCASYL
FT                   AADPKGPEDDYVSVLPLPWIMEQIYALGQALLSRMTVNFVEEADTLMHDFREIAPTFVL
FT                   FAPRVWEAIAADVRARMMDASPLKRWLYERGMARGLRALEAGRRSPVAEAVLFRALRDR
FT                   LGFTRLRSAATGGAALGPDTFRFFRALGVPLRQLYGQTEAMGAYTLHRGDRVDFDTVGM
FT                   PFDDSITVRIVDPDRNGIGEIWARHDNMFLGYYKAPEGTGDVVDGWMHTGDAGYLDAKG
FT                   ELVVIDRVKDLALNARGERFSPQYLENKLKFSPYVAEAVILGAGRDDLAAVICIRFSVV
FT                   AKWAEKNRIAFTTYSDLAAKPEVIALLKAEVERVNASLPETQRIARFVLLYKELDADDG
FT                   ELTRTRKVRRGVINEKYADLIAAIYAGQPSYRVDTVIRFQDGSTQRIRTTLPVTDLRRA
FT                   VPVLAAAE"
     atgggaaccg acttcgcggc ccgcgcggcc aaggccgaca ccttcccgaa gctcctggcg        60
     ctcaacgccc gcgaacaccc gcacgcggtc gccctgcgcg agaaggatct cgggctgtgg       120
     cgcccgacga cctggagcca gtatcaggac cgcgtgcgcg ccttcgcgct gggcctgcgc       180
     gatctcggca tcggcgaggg cgacgtcgtc gggctgatcg gcgacaaccg gccggactgg       240
     gtggcgggcg agatcgccgc ccacgcgctc ggcgccctca cgctcggcct ctaccgcgac       300
     gcgctggagg acgaggtcca ctatctgctc gactacggcg aggcccgcgt ggtcttcgcc       360
     gaggacgagg agcaggtcga caagctcatc ggcctcgccg accgcgtgcc gagcctgcgc       420
     cacatcgtct attccgaccc gcgcggcatg cggaaatacg acgaccgccg cctgatctcg       480
     gccgaggcgc tggccaggcg cggcgcggcg ctggaggcgg ccgagcccgg cctctacgag       540
     cggctggtcg aggccacgga cggcgaggcg gtggcgatcc tctgcaccac ctcgggcacg       600
     accgcgcgcc cgaagctcgc gatgctgagc gcaggccggg tgctgcgcca ctgcgcgagc       660
     tatctcgctg ccgacccgaa gggcccggag gacgactacg tctcggttct ccccctgccc       720
     tggatcatgg agcagatcta cgcgctcggt caggcgctgc tctcgcggat gacggtgaac       780
     ttcgtcgagg aagccgatac cctgatgcac gacttccggg agatcgcccc gaccttcgtg       840
     ctgttcgccc cgcgggtctg ggaggccatc gcggcggatg tgcgcgcccg gatgatggac       900
     gcctcgcccc tcaagcgatg gctgtacgag cgcggcatgg cgcggggcct ccgggccctc       960
     gaggccgggc ggcgctcgcc cgtcgccgag gccgtcctgt tccgggcgct ccgcgaccgg      1020
     ctcggcttca cccgcctgcg ctccgcggcg accggcggcg cggccctcgg ccccgacacg      1080
     ttccggttct tccgggcgct cggcgtgccg ctgcgccagc tctacgggca gaccgaggcc      1140
     atgggcgcct acacgctcca ccgcggcgac agggtcgatt tcgacacggt gggcatgccc      1200
     ttcgacgaca gcatcacggt gcgcatcgtc gatccggacc gcaacggcat cggcgagatc      1260
     tgggcccgcc acgacaacat gttcctcggc tactacaagg cgccggaggg cacgggcgac      1320
     gtggtcgacg gctggatgca cacgggcgat gccggctatc tcgacgccaa gggcgagctc      1380
     gtcgtcatcg accgggtcaa ggatctcgcg ctcaatgccc gcggcgagcg cttctcgccg      1440
     caatacctgg agaacaagct caagttctcg ccctacgtgg cggaggccgt gatcctcggg      1500
     gccgggcgcg acgatctggc ggcggtgatc tgcatccgct tctcggtcgt ggcgaaatgg      1560
     gcggagaaga accgcatcgc cttcaccacc tacagcgacc tcgccgccaa gcccgaggtc      1620
     atcgcgctcc tcaaggcgga ggtcgagcgc gtcaacgcca gcctcccgga gacgcagcgc      1680
     atcgccagat tcgtgctcct ctacaaggaa ctcgacgccg acgacggcga gctcacgcgc      1740
     acccgcaagg tccgccgcgg cgtgatcaac gagaaatacg ccgacctgat cgcggcgatc      1800
     tatgcgggcc agccgagcta ccgggtcgac accgtgatcc gcttccagga tggcagcacg      1860
     cagcgcatcc gcaccacgct gccggtgacc gacctgcgcc gggctgtgcc ggtccttgcc      1920
     gccgccgaat ag                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page