(data stored in ACNUC7421 zone)

EMBL: CP001349.PE29

CP001349.PE29        Location/Qualifiers
FT   CDS_pept        complement(29671..30090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0030"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   met:M446_0027 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55081"
FT                   /db_xref="GOA:B8IT19"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT19"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL55081.1"
FT                   /translation="MPATEDTTTDLPRGDLTVRTIAMPADTNANGDIFGGWVMSQMDQA
FT                   GGIAGVERAQGRVVTVAVEGMSFIRPVRVGDVLCVYTRVVQVGRTSMRIEIEAWARRFR
FT                   TQLREKVTQASFTFVAIDDEGRPRPVPPAPKAERP"
     atgcccgcca ccgaggacac cacgaccgac cttccccgcg gcgatctcac cgtgcgcacg        60
     atcgccatgc ccgccgacac caacgccaac ggcgatatct tcggcggctg ggtgatgtcg       120
     cagatggacc aagcgggcgg catcgccggg gtcgagcggg cgcagggccg cgtcgtgacg       180
     gtggccgtcg aagggatgag cttcatccgc cccgtccggg tcggggacgt gctgtgcgtc       240
     tacacccggg tcgtccaggt aggccgcacc tcgatgcgca tcgagatcga ggcctgggcc       300
     cggcgcttcc gcacgcagct gcgcgagaag gtgactcagg ccagcttcac cttcgtggcg       360
     atcgacgacg agggccggcc gcgcccggtg ccgcccgctc cgaaagcaga gcggccatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page