(data stored in ACNUC7421 zone)

EMBL: CP001349.PE290

CP001349.PE290       Location/Qualifiers
FT   CDS_pept        338959..339852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0298"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2307 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55342"
FT                   /db_xref="GOA:B8IAU9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU9"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55342.1"
FT                   /translation="MTSHLLVQLVLNGLIVGALYGVVAMSFVLIYKASQVVNFAQGEFL
FT                   LIGAWICWWLLTTYQLPFVVGMLVTFAFMLVFGIALQVVVLRPLIGEPIISVIMVTIGL
FT                   SIFFQALCKWLFGVFAQPFPPIFATQSVSILGLEIQTVYLMSLGISVAMMAAFAWFFRF
FT                   SRHGLAMRATAFDQQVAQSLGIPVRNVFAMAWAISAVVSSVAGIVVGIVNGVSSALSLY
FT                   GIKVFPAVILGGLDSVVGAVIGGLVIGLLENIAQYVDGQYLHWGNLYEIVPFYVLVVIL
FT                   MIKPYGLFGTRDIERV"
     atgacctccc atctcctcgt ccaactcgtc ctgaacgggc tcatcgtcgg cgcactctac        60
     ggcgtcgtcg ccatgagctt cgtcctgatc tacaaggcga gccaggtcgt gaacttcgcg       120
     cagggcgaat tcctgctgat cggcgcctgg atctgctggt ggctgctgac cacctaccag       180
     ctgccgttcg tcgtcggcat gctcgtcacc ttcgcgttca tgctggtctt cggcatcgcg       240
     ctgcaggtcg tggtgctgcg cccgctgatc ggcgagccga tcatctcggt catcatggtg       300
     acgatcggcc tctcgatctt cttccaggcc ctgtgcaagt ggctgttcgg ggtgttcgcc       360
     cagcccttcc cgccgatctt cgcgacgcaa tcggtgtcga tcctcggcct ggagatccag       420
     accgtctatc tgatgagcct cggcatctcg gtcgccatga tggcggcctt cgcgtggttc       480
     ttccgcttct cccggcacgg cctcgccatg cgggccaccg ccttcgacca gcaggtggcg       540
     cagtcgctcg gcatcccggt gcgcaacgtc ttcgcgatgg cctgggcgat ctcggcggtg       600
     gtgtcctcgg tcgccggcat cgtggtcggc atcgtcaacg gggtgtcctc ggccctgtcg       660
     ctctacggca tcaaggtctt cccggcggtc atcctgggcg ggctcgattc cgtcgtcggc       720
     gcggtgatcg gcggcctcgt catcgggctc ctggaaaaca tcgcccagta tgtcgacggg       780
     cagtacctgc actggggcaa cctctatgag atcgtgccct tctacgtgct ggtcgtgatc       840
     ctgatgatca aaccctacgg cctgttcggc acccgcgaca tcgagcgcgt ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page