(data stored in ACNUC7421 zone)

EMBL: CP001349.PE291

CP001349.PE291       Location/Qualifiers
FT   CDS_pept        339860..340933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0299"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2306 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55343"
FT                   /db_xref="GOA:B8IAV0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55343.1"
FT                   /translation="MATQSLIPAGDFRTSYAADTTLFPTAGSRYAVWAGLALLCLAPLI
FT                   LDRYWLSLLIQIGYFAVAALGLNILVGFTGQISIGHAAFFGFGAFASAWLSNNLAIPVF
FT                   FAIPLSGIVTTAVGLVFGLPAARLKGLYLAIATLAAQYILQDFFARANWFTGGVAGTPA
FT                   EAFSILGFAFDTDQRYFYVVLAYLVLTFVLASNLMHSRDGRALVAVRDHYLSAEMMGIN
FT                   LTRYRTLSFGLSAFFAGVGGALYAHYLQFVSVEGFGILLSIQFLGMIIIGGLGSIMGTL
FT                   MGTAFMVLVPEAMGWITDAVRGSALDRALALKDNLSFLREMAIGLVIVLFLIFEPDGLA
FT                   HRWRQIKAYWKLYPFSH"
     atggcgaccc aaagcctgat cccggccggc gacttccgca ccagctacgc ggccgacacc        60
     accctcttcc cgaccgcggg cagccgctat gcggtctggg ccggcctcgc gctcctctgc       120
     ctcgcgccgc tgatcctcga ccgctactgg ctgagcctgc tcatccagat cggctatttc       180
     gcggtggcgg cgctcggcct caacatcctg gtcggcttca ccgggcagat ctcgatcggg       240
     catgccgcct tcttcggctt cggcgccttc gcctccgcgt ggctgtcgaa caatctcgcg       300
     atcccggtct tcttcgcgat cccgctctca ggcatagtca ccaccgcggt cgggctcgtc       360
     ttcggcctgc cggcggcccg cctcaagggc ctctacctcg ccatcgcgac gctcgccgcg       420
     cagtacatcc tgcaggactt cttcgcccgg gcgaactggt tcacgggcgg cgtcgccggc       480
     acgccggccg aggccttctc gatcctcggc ttcgccttcg acaccgacca gcgctacttc       540
     tacgtggtcc tcgcctatct ggtgctgacc ttcgtgctcg cctccaacct gatgcacagc       600
     cgcgacggcc gcgccctggt ggcggtgcgc gaccattatc tctcggccga gatgatgggg       660
     atcaacctca cgcgctaccg caccctgtcc ttcgggctct cggccttctt cgccggggtc       720
     ggcggcgcgc tctatgccca ttacctgcaa ttcgtctcgg tcgagggctt cgggatcctg       780
     ctgtcgatcc agttcctcgg catgatcatc atcgggggcc tcggctcgat catggggacc       840
     ctgatgggca ccgccttcat ggtgctggtg ccggaagcga tgggctggat caccgacgcg       900
     gtgcgcggct ccgccctcga ccgggcgctc gccctcaagg acaacctctc cttcctgcgc       960
     gagatggcga tcggcctcgt gatcgtcctg ttcctgatct tcgagccgga cggcctcgcc      1020
     catcgctggc gccagatcaa ggcgtactgg aaactctacc cgttctcgca ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page