(data stored in ACNUC7421 zone)

EMBL: CP001349.PE292

CP001349.PE292       Location/Qualifiers
FT   CDS_pept        340992..342272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0300"
FT                   /product="putative branched-chain amino acid ABC transport
FT                   system substrate-binding protein"
FT                   /note="KEGG: met:M446_2305 putative branched-chain amino
FT                   acid ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55344"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV1"
FT                   /inference="similar to AA sequence:KEGG:M446_2305"
FT                   /protein_id="ACL55344.1"
FT                   /translation="MLRPITLVPALALGLALGLPARAADVPIGHLADQSGATSDVGVPY
FT                   AQGVADALAWINRKGGVGGQKLAVETVDYGYQVPRAVAQYKKWTSGRDRVAAIQGWGTA
FT                   DTEALSAFVAKDEIPYISGSYAAQVSDPTGSSGKAKAAPYNFFYGPTYSDALRAMLIWA
FT                   AEDWKSKGKAGKPKYVHMGGNHPYPNSPKEAGEAMAKELGFEVLPAIVFALAPGDYTAQ
FT                   CLTAKNAGANYAYLGNTGGSNISLLKSCKAVGADIQFMGNVWGMDENAAKAAGEAANGV
FT                   VFPVRTATVTGGSAPGLKTIAEISKESDPAGTAYRPVHYLAGVCAALYMSEAIGWAKDN
FT                   GGISGPNVRKGFYQKKNWVPAGLEGVCVPSTWSETDHRGMMVVNIYRAKVSGATDGALA
FT                   DLIRAGTVKLEPVKTVELPRKPDWLGW"
     atgcttcgtc ccatcaccct ggtccccgcg ctcgccctcg ggctcgcgct cggcctgccc        60
     gcccgcgccg ccgacgtgcc gatcggccac cttgccgacc agagcggcgc cacctcggat       120
     gtcggcgtgc cctatgccca gggcgtcgcg gatgccctcg cctggatcaa ccgcaagggc       180
     ggcgtcggcg gccagaagct cgccgtcgag acggtcgatt acggctatca agtcccgcgc       240
     gcggtcgccc aatacaagaa gtggacgagc gggcgcgacc gggtcgcggc gatccagggc       300
     tggggcaccg ccgataccga ggcgctctcg gccttcgtcg ccaaggacga gatcccctac       360
     atctcgggct cctacgccgc gcaggtgagc gacccgaccg gctccagcgg caaggccaag       420
     gccgcgccct acaacttctt ctacgggccg acctattcgg acgcgctgcg cgccatgctg       480
     atctgggcgg ccgaggactg gaagagcaag ggcaaggccg gcaagcccaa atacgtccat       540
     atgggcggca accaccccta cccgaactcg cccaaggagg cgggcgaggc gatggcgaag       600
     gaactcggct tcgaggtgct gccggccatc gtcttcgccc tggcgccggg cgactacacg       660
     gcccagtgcc tgacggcgaa gaatgccggg gcgaactacg cttatcttgg caataccggc       720
     ggctcgaaca tctcgctgct caagtcctgc aaggcggtgg gcgccgatat ccagttcatg       780
     ggcaatgtct ggggcatgga cgagaacgcc gccaaggccg cgggcgaggc cgccaacggc       840
     gtggtcttcc cggtgcgcac cgccacggtg acgggcggca gcgcgcccgg cctcaagacg       900
     atcgcggaga tctcgaagga atcggatcct gcgggcacgg cctaccggcc ggtgcattat       960
     ctcgcggggg tctgcgcggc gctctacatg agcgaggcga tcggctgggc caaggacaat      1020
     ggcggcatca gcggcccgaa cgtccgcaag ggcttctacc agaagaagaa ctgggtgccg      1080
     gccggcctgg agggcgtctg cgtgccctcc acctggtccg agaccgatca ccgcgggatg      1140
     atggtggtga acatctatcg ggcgaaggtc tcgggcgcca ccgacggcgc cctcgccgac      1200
     ctgatccggg ccgggaccgt gaagctcgag ccggtgaaga ccgtggaact gccccgcaag      1260
     ccggactggc tcggctggta g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page