(data stored in ACNUC7421 zone)

EMBL: CP001349.PE293

CP001349.PE293       Location/Qualifiers
FT   CDS_pept        342397..343233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0301"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2304 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55345"
FT                   /db_xref="GOA:B8IAV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55345.1"
FT                   /translation="MPQITTLERPAAEAASAPLLALRNVEVVYDDVILVLRGLSLDVPA
FT                   GSITALLGANGAGKSTTLKAISGLLRSENGEVTRGEVLFDGERIDGIEPDLIVRRGIFQ
FT                   VMEGRRIIADMTPMENLRLGAFSRRDRAVAEDLERVLTYFPRLKERTGAAGYLSGGEQQ
FT                   MLAIGRALMARPRLILMDEPSMGLSPLLVKEVFSIIRQINRDLGVTILLVEQNARAALA
FT                   VADRGYIMEQGKVVLDGTVEELRANEDVKEFYLGGAGDQRKTFKNLKSFKRRKRWL"
     atgccccaga tcacaaccct ggagcgcccc gccgcggagg cggcgagcgc cccgctcctg        60
     gcgctgcgca acgtcgaggt cgtgtacgac gacgtcatcc tggtgctgcg gggcctcagc       120
     ctcgacgtgc cggccggctc gatcacggcc ctgctcgggg ccaacggggc gggcaagtcg       180
     acgacgctga aggccatctc ggggctcctg cgctcggaga acggcgaggt cacccgcggc       240
     gaagtgctgt tcgacggtga gcgcatcgac gggatcgagc ccgacctgat cgtgcgccgc       300
     ggcatcttcc aggtgatgga gggccggcgg atcatcgccg acatgacccc gatggagaat       360
     ctgcggctcg gcgccttctc gcggcgcgac cgcgccgtcg cggaggacct ggagcgggtg       420
     ctcacctatt tcccgcggct gaaggagcgc accggcgcgg cgggctatct gtcgggcggc       480
     gagcagcaga tgctggcgat cggccgcgcg ctcatggcca ggccccgcct gatcctgatg       540
     gacgagccct cgatgggcct ctcgccgctc ctggtgaaag aggttttttc catcatccgg       600
     cagatcaacc gggatctcgg cgtcaccatc ctgctcgtgg agcagaacgc ccgcgcggcg       660
     ctcgccgtcg ccgaccgcgg ctacatcatg gaacagggca aggtcgtgct cgacggcacg       720
     gtcgaggagc tgcgcgccaa cgaggacgtg aaggaattct atctcggcgg ggccggcgac       780
     cagcgcaaga ccttcaagaa cctgaagagc ttcaagcgcc gcaagcgctg gctctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page