(data stored in ACNUC7421 zone)

EMBL: CP001349.PE294

CP001349.PE294       Location/Qualifiers
FT   CDS_pept        343308..343553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV3"
FT                   /inference="similar to AA sequence:KEGG:M446_2303"
FT                   /protein_id="ACL55346.1"
FT                   /translation="MPNATYLTPDEVEAYARAGEEALKLCLRRHLAEEQAAFWHAIRLC
FT                   YGQSLSPLPAADLAALPAAAIPAPHVLQGAVPVELQ"
     atgccgaacg ccacctacct cacgccggac gaagtcgaag cctatgccag ggccggcgag        60
     gaggcgctga agctgtgcct tcgccgccat ctggcagagg agcaggccgc gttctggcac       120
     gccatccggc tctgctacgg gcagagcctc tcgcctctcc ctgcggccga cctcgccgcc       180
     ctccccgcgg ccgcgattcc ggcgccgcat gtgctccagg gcgccgtccc cgtcgagctg       240
     caatag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page