(data stored in ACNUC7421 zone)

EMBL: CP001349.PE295

CP001349.PE295       Location/Qualifiers
FT   CDS_pept        343838..344839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0303"
FT                   /product="Asparaginase/glutaminase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: met:M446_2302
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55347"
FT                   /db_xref="GOA:B8IAV4"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV4"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ACL55347.1"
FT                   /translation="MAQRPKVAFIGTGGTMSSIGRDRLDLLDYTATDKRLEADAILDAV
FT                   PEARAVAEVIPVRFRAVTSPAIGFGVWRDLVRLCEQQVAAHPDLAGIVIGHGTATLEET
FT                   AYALSLTLTVEVPVVLVGSQRPISALSSDAPLNLVNAIRTAAAPQSRGRGVLVVLNDEI
FT                   QAARDVTKTSVARMQTFRTADFGILGQVDGPSVTYYRRSERRYAPDTEFDIRALPALPR
FT                   VDISYGYADADGTAVRAFVAAGARGIVSAGLAPGMTPPAEADALETAAQAGILVVQSTR
FT                   AGSGIVPLTTRLHQRGILSADNLTPQKARILLALALTVTSDPRAVAEIFATY"
     atggcgcagc ggccgaaggt ggctttcatc ggtacgggcg ggacgatgtc gtccatcggc        60
     cgggacagac tcgacctcct cgactacacg gcgaccgaca agcggctcga ggcggatgcg       120
     atcctcgacg ccgtgccgga agcgcgcgcg gtcgcggagg tgatcccggt ccggttccgg       180
     gcggtgacaa gtccggccat cggattcggc gtgtggcgcg acctcgtccg gctctgcgag       240
     cagcaggtcg cggcgcatcc cgacctcgcc ggcatcgtca tcggccacgg caccgccact       300
     ctggaggaaa ccgcctatgc gctctccctc accctcacgg tcgaggtgcc ggtggtgctc       360
     gtgggctccc agcggccgat cagcgccctg tcgagcgacg cgcccctcaa cctcgtcaac       420
     gcgatccgca ccgccgccgc cccgcaatcc cgcggccggg gcgtgctcgt cgtcctcaac       480
     gacgagatcc aggccgcccg cgacgtgacc aagacgtcgg tcgcccggat gcagaccttc       540
     cgcacggcgg atttcggcat cctggggcag gtggacggcc cctccgtcac ctactaccgc       600
     cgcagcgagc gccgctatgc gccggacacc gaattcgaca tccgtgccct gccggcgctg       660
     ccgcgggtcg acatctccta cggctacgcc gatgcggatg gcaccgcggt gcgggccttc       720
     gtggcggcag gggcccgcgg catcgtctcg gcgggcctcg cccccggcat gacgccgccg       780
     gccgaggccg acgcgctcga gacggccgcg caggcgggga tcctggtcgt gcagtcgacc       840
     cgggccggga gcggaatcgt gcctctgacg acgcgcctgc accagcgcgg catcctcagc       900
     gccgacaatc tcacgccgca gaaggcgcgc atcctcctcg cgctcgccct caccgtcacg       960
     tcggatccgc gggccgtcgc cgagatcttc gcgacctact ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page