(data stored in ACNUC7421 zone)

EMBL: CP001349.PE296

CP001349.PE296       Location/Qualifiers
FT   CDS_pept        345092..345352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55348"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV5"
FT                   /inference="similar to AA sequence:KEGG:M446_2301"
FT                   /protein_id="ACL55348.1"
FT                   /translation="MQRFYFNAQIGEVLVADLAGEPLPDAEQAWHASQAIAAAMMREPR
FT                   TRDTLMEASLVVTNEAGEVVIDLPFAEADLFVAEPEHASAA"
     atgcagcgct tctacttcaa tgcccagatc ggcgaggtcc tggtggccga tctcgccggc        60
     gagcccctcc ccgatgccga gcaggcctgg cacgcctccc aggccatcgc cgccgcgatg       120
     atgcgcgagc cgcggacccg cgacacgctc atggaggcga gcctcgtcgt caccaacgag       180
     gcgggcgagg tggtgatcga cctgcccttc gcggaggcgg atctgtttgt cgcggagccg       240
     gagcacgcct ccgccgccta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page