(data stored in ACNUC7421 zone)

EMBL: CP001349.PE297

CP001349.PE297       Location/Qualifiers
FT   CDS_pept        complement(345479..346777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0305"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_2300 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55349"
FT                   /db_xref="GOA:B8IAV6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55349.1"
FT                   /translation="MSNAFAAGGAPPASRRPFGRNYAFVVVGVVFLALLAAAGLRAAPG
FT                   VLILPLEQAFGWSRATISFSAGLGIFLYGLVGPFAAALMQSFGIRRTLLCALALMAAST
FT                   GLSAFMSEPWHLVATWGLLSGLGSGCVAIVLGATVVNRWFAAHRGLVMGILTASTATGT
FT                   LVFLPGLAAIAAAGGWQPVVLTVAGVIAALIPLVTWLLPERPADIGLLPYGAAPGAVVE
FT                   PLRRANPFRTAIEGLVRASRKSDFWLLFGTFYICGLTTNGLVGTHMISFCADMGLPEVR
FT                   AAGLLALMGIFDLIGTTGSGWLTDRYDPRKLLFVYYGLRGLSLMALPFTDFSFYSLSIF
FT                   AVFYGLDWIATVPPTVRLTNEVFGERDAPIVFGWIAAGHQAGAATAAFGAGLSRAVEGR
FT                   YLEAFLAAGLTGLVAAMMSLMIGRAARRAVATA"
     atgtcgaacg ccttcgccgc ggggggcgcg cccccggctt cgcgccggcc gttcggccgg        60
     aactatgcct tcgtggtggt gggcgtggtc ttcctggccc tgctcgcggc cgccggcctg       120
     cgggcagcgc cgggcgtgct gatcctgccg ctggagcagg ccttcggctg gagccgcgcc       180
     acgatctcgt tctcggcggg cctcggcatc tttctgtacg ggctggtcgg gcccttcgcg       240
     gcggcgctga tgcagagctt cggcatccgc cggaccctgc tctgcgcgct ggcgctgatg       300
     gccgcttcga cgggcctttc cgcattcatg agcgagccct ggcacctcgt cgccacctgg       360
     gggctgctgt cgggcctcgg cagcggctgc gttgccatcg tgctcggcgc gaccgtggtg       420
     aaccgctggt tcgccgccca tcgcggcctc gtcatgggca tcctcaccgc gagcacggcg       480
     accggcacgc tggtcttcct gcccggcctc gccgccatcg cggcggcggg cggctggcag       540
     ccggtggtgc tgaccgtggc gggcgtgatc gcggccctga tcccgctggt gacctggctc       600
     ctgcccgagc ggcccgccga tatcggcctt ctgccctacg gggccgcgcc cggcgcggta       660
     gtcgagccgc tgcggcgcgc gaaccccttt cgcaccgcca tcgagggcct cgtgcgggcg       720
     agccgcaagt ccgacttctg gctcctgttc ggcaccttct acatctgcgg gctcaccacc       780
     aacgggctcg tgggcacgca catgatctcc ttctgcgccg atatgggcct gccggaggtg       840
     cgcgcggcgg ggctgctcgc gctgatgggc atcttcgacc tgatcggcac caccggctcc       900
     ggctggctca ccgaccggta cgacccgcgc aagctgctct tcgtctatta cggcctgcgc       960
     ggcctgtcgc tgatggcgct gcccttcacg gacttctcgt tctacagcct gtcgatcttc      1020
     gcggtcttct acgggctcga ctggatcgcg acggtgccgc cgaccgttcg gctgacgaac      1080
     gaggtcttcg gcgagcgcga cgcgccgatc gtgttcggct ggatcgcagc cggacatcag      1140
     gcgggcgccg ccacggcggc cttcggggcc ggcctatcgc gtgccgtcga gggccgctac      1200
     ctcgaagcct tcctggccgc ggggctcacc gggctcgtcg ccgcgatgat gtcgctgatg      1260
     atcggccgcg ccgcccgccg ggcggtggcg acggcttga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page