(data stored in ACNUC7421 zone)

EMBL: CP001349.PE298

CP001349.PE298       Location/Qualifiers
FT   CDS_pept        346902..347462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0306"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: met:M446_2299
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55350"
FT                   /db_xref="GOA:B8IAV7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55350.1"
FT                   /translation="MRAGDRIRAAARDLFYRRGIRAVGVEEIVERAGVTKPSLYRGFAS
FT                   KDALAVACLEDFAAAFQARLETALSAHPGDARAGLMAFLADLTDRTSRPGYRGCGLSNA
FT                   VIEHPEPDHPARRAALASKRVLRARLEEIARDLGAREPEGLADGLLLLIEGAFASGQIF
FT                   GPGGPARSLTRAAEALIAASRAA"
     atgcgggccg gggaccgcat ccgggcggcg gcccgcgatc tgttctaccg tcgcggcatc        60
     cgggccgtgg gcgtcgagga gatcgtcgag cgggcaggcg tcacgaagcc gagcctctac       120
     cgcggcttcg cctcgaagga cgccctcgcg gtggcctgcc tggaggattt cgccgccgcc       180
     ttccaggccc gtctggagac ggcgctctcg gcccatcccg gagatgcgcg ggccgggctg       240
     atggccttcc tggcggatct gaccgaccgc acctcccggc cgggctaccg cggctgcggc       300
     ctgtcgaatg cggtgatcga gcatcccgag ccggaccatc cggcccgccg ggcggcgctc       360
     gcgagcaagc gggtcctgcg ggcgcgcctg gaggagatcg cccgcgacct cggcgcccgc       420
     gagccggagg gactcgccga cggccttctc ctgctgatcg agggagcctt cgcgagcggg       480
     cagatcttcg ggcccggcgg cccggcccgc agcctgaccc gggccgccga ggcgctcatc       540
     gccgcaagcc gcgccgcgtg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page