(data stored in ACNUC7421 zone)

EMBL: CP001349.PE299

CP001349.PE299       Location/Qualifiers
FT   CDS_pept        347665..348471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55351"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV8"
FT                   /inference="similar to AA sequence:KEGG:M446_2298"
FT                   /protein_id="ACL55351.1"
FT                   /translation="MTLVRRFLVAPSLVRLIRKERGASRITEGYFQPQAGRTSFVRVDG
FT                   TQCHLVLMTTDEAGVSGEERTEVPRAHGDALLDVCAGKAAYDRTVIALGNGRDALVDRY
FT                   ATPGALDLISVAFAEADEASGFAPPAWFGPEVTADTAYLGSSIALQGTPQPGEVPLSNA
FT                   ALDAVLDLVEHRYGFGRYGAPRTDDANTVTNALRRLATRPPGEAAAAPASKPETQAGEE
FT                   PGDARIDDVIESLSQALGATVPGEGGREEGAAFERWTVRPRRTQPT"
     atgaccctcg tgcggcgttt cctggtggcg ccatccctgg tccggctgat ccggaaggaa        60
     cgcggcgctt cccgcatcac ggagggctat ttccagcccc aggcgggccg cacctccttc       120
     gtgcgcgtcg atggcacgca gtgccatctg gtgctgatga cgacggacga ggccggcgtg       180
     tcgggcgaag agcggacgga agtgccgcgc gcccacgggg acgcgctcct cgacgtctgc       240
     gccggcaagg ccgcctatga ccgcaccgtc atcgcgctcg gcaacgggcg cgacgcgctg       300
     gtggaccgct acgcgacccc gggcgccctc gacctcatct cggtcgcctt cgcggaagcc       360
     gacgaggcct ccggcttcgc gccaccggcc tggttcggcc ccgaggtgac ggcggatacg       420
     gcctatctcg gctccagcat cgccctgcag gggacgccgc agccgggcga ggtcccgctc       480
     agcaacgcgg cgctcgacgc ggtgctcgat ctcgtggagc accgctacgg cttcggacgc       540
     tacggcgcac cgcgcacgga cgatgccaat acggtgacca acgccctgcg ccggctcgcc       600
     acgcggcctc ccggcgaggc cgcggccgcg ccggcgtcca agccggagac ccaggccggc       660
     gaggagcccg gcgacgcccg catcgacgac gtcatcgaga gcctgtccca ggcgctcggc       720
     gccaccgtcc cgggcgaggg cggacgcgag gagggcgcag ccttcgagcg ctggacggtc       780
     cgcccgcggc gcacgcagcc gacctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page