(data stored in ACNUC7421 zone)

EMBL: CP001349.PE3

CP001349.PE3         Location/Qualifiers
FT   CDS_pept        2901..4049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: met:M446_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55055"
FT                   /db_xref="GOA:B8ISZ3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ3"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACL55055.1"
FT                   /translation="MAAPDPFRVTRLIARDFRNHASLDLGVSRPFVALVGENGAGKTNI
FT                   LEALSLFAPGRGLRRADFAAMAREGGPGGFAVSLNLAGPHGEHRVGTAWEPPQTREERA
FT                   GRLCRIDGASAPSPTAFAEHLRVVWLTPDLDALFRGPAGERRRFLDRLVLAVDAGHGAR
FT                   VSALERALRSRNRLLEERPDDTPWLDAVEREVAELAIAVALARRETVERLDRLILASRD
FT                   EASPFPWAGVRLEGEIDDLVAVWPAVDAEDRFRAMLRQNRFRDRAAGRTLAGPQASDLL
FT                   VRHGPKDVPAGTASTGEQKALLIGLVLAHARLVAGMSGLPPLVLLDEVAAHLDPRRRAG
FT                   LFDALEALPGQVWMTGADPALFAELGNRGDLIAVADGHLAPG"
     atggccgccc ccgacccctt tcgcgtcacg cgcctcatcg cccgggattt ccgcaatcac        60
     gcgagcctcg atctcggcgt gagccggccc ttcgtcgccc tggtgggcga gaacggcgcc       120
     ggcaagacca acatccttga agcgctctcg ctgttcgcgc ccggacgcgg cctgcgccgg       180
     gcggacttcg ccgccatggc ccgcgagggc gggccggggg gcttcgcggt ctcgctgaac       240
     cttgccgggc cgcatggcga gcaccgggtc ggcaccgcct gggagccgcc gcagacccgc       300
     gaggagcgcg caggccggct ctgccgcatc gatggggcga gcgcgccctc ccccacggcc       360
     ttcgccgagc atctgcgggt ggtctggctc acgccggacc tcgatgcgct gttccgtggc       420
     ccggcagggg agcggcgccg cttcctcgac cggctggtcc tcgcggtcga tgccggccac       480
     ggcgcccggg tgagcgcgct cgaacgggcg ctgcgctccc gcaaccgcct cctggaggag       540
     cggcccgacg acactccctg gctcgacgcg gtggagcgcg aggtggcgga actcgccatc       600
     gcggtggcgc tcgcccgccg cgagacggtg gaacgcctcg accgcctcat cctcgccagc       660
     cgggacgagg cctcgccctt cccctgggcg ggggtgcggc tcgaaggcga gatcgacgac       720
     ctcgtggcgg tctggccggc ggtcgatgcg gaggaccgct tccgcgcgat gctgcgccag       780
     aaccgttttc gcgatcgcgc cgccggccgc accctcgccg gcccgcaagc ctccgacctg       840
     ctcgtgcgcc acggccccaa ggatgtgccg gccggcaccg cctccaccgg cgagcagaag       900
     gcgctgctga tcggcctcgt gctcgcccat gcgcggcttg tcgccggcat gagtggcctg       960
     ccgcccctcg tcctcctcga cgaggtcgcg gcccatctcg acccgcgccg ccgcgccggc      1020
     ctgttcgatg cgctcgaagc cctgcccgga caggtctgga tgacgggggc ggatccggcc      1080
     ctcttcgccg aactcggcaa ccgcggcgac ctgatcgcgg tcgcggatgg ccacctcgct      1140
     cccggctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page