(data stored in ACNUC7421 zone)

EMBL: CP001349.PE30

CP001349.PE30        Location/Qualifiers
FT   CDS_pept        30342..31670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0031"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   SH3 type 3 domain protein; KEGG: met:M446_0029 peptidase
FT                   C14 caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55082"
FT                   /db_xref="GOA:B8IT20"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT20"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACL55082.1"
FT                   /translation="MPENRCPFLLDITPRQHPVALSGSCSRSLPEGEGLVRRVWLWLIL
FT                   WAAMVHEAAAANRLAFVVGVDTYPNLGPAAALERPVADARAVAETLEAIGFRVTLLSAA
FT                   VTQETFLRRFGAFADQVQPGDTALFYFAGHGIALQGTNYLLPSDIPAIEPGQELLARTR
FT                   ALAEADLSAALRERGARVVVMVIDACRDNPFPRAGTRSVGLSRGLARTEPAEGVFSLYA
FT                   AGAGQQALDRLPGRDPSPNSVFTRVFVAQLRRPGLNLIDLGETVRDEVVKLAETVPHKQ
FT                   VPAYYNEVRGARFISLAGAEAAPRPAVDPPPAAPRPAEAPGAATPPALPASVPPVPPAV
FT                   APSRPPATWPPSAPAAGEPLRDARIGLFSHPVRLDPGGDNWLALRSRPSASEGVRLMKL
FT                   GPDSLFTVLGRQGVWLNVRLRTGETGWVHGDYVGCCRRAPLLP"
     gtgccggaga accggtgtcc atttctcctg gacataactc ctaggcagca tccggtcgcc        60
     ctgagcggaa gctgctcccg gtcattgccc gagggagagg ggctcgtgcg gcgcgtctgg       120
     ctctggctga tcctgtgggc cgccatggtc cacgaggccg cggcggccaa ccggctcgcc       180
     ttcgtggtcg gggtcgacac ctatccgaat ctcgggcccg ccgccgccct ggagcggccg       240
     gtcgccgatg cgagggcggt ggccgagacc ctcgaggcga tcggcttccg ggtgacgctc       300
     ctctccgccg cggtgacgca ggagaccttc ctgcgccgtt tcggcgcctt cgcggaccag       360
     gtgcagcccg gcgacacggc cctgttctac ttcgcgggcc atggcatcgc gctccagggc       420
     acgaactacc tgctgccctc cgacattccg gcgatcgagc cgggccagga actcctcgcc       480
     cgcacgcgtg cgctcgccga ggcggacctg agcgcggccc tgcgcgagcg cggcgcccgg       540
     gtcgtcgtca tggtgatcga tgcctgccgg gacaatccct tcccgcgcgc cgggacgcgg       600
     agcgtcggcc tgagccgcgg cctcgcgcgg accgagcccg ccgagggcgt cttctcgctc       660
     tacgcggccg gcgcgggcca gcaggccctc gaccgcctgc ccggccggga cccgagcccg       720
     aactccgtct tcacccgggt cttcgtggcg cagctgcggc ggccggggct caacctcatc       780
     gatctcggcg agacggtgcg cgacgaggtg gtgaagctcg ccgagaccgt gccgcacaag       840
     caggtgcccg cctactacaa cgaggtgcgc ggcgcccgct tcatcagcct cgccggtgca       900
     gaggccgctc cccggccggc ggtcgatccg ccgcccgcgg cgccgcgtcc ggccgaggcg       960
     ccgggcgccg ccacgccgcc ggccctcccg gcctcggttc cgccggtccc gccggccgtc      1020
     gctccgtccc gccctccggc gacatggccg ccgtcggccc cggctgcggg cgagccgctc      1080
     cgggacgcga ggatcggcct gttcagccat ccggtgcggc tcgatccggg cggcgacaac      1140
     tggcttgccc tgcgcagccg cccgagcgcc agcgagggtg tgcgtctgat gaagctcggc      1200
     cccgattcgc tcttcacggt gctgggccgg cagggcgtct ggctcaacgt gcgcctgcgc      1260
     accggcgaga ccggctgggt ccatggcgac tatgtcggct gctgccgtcg ggcgccgctg      1320
     ctgccgtga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page