(data stored in ACNUC7421 zone)

EMBL: CP001349.PE300

CP001349.PE300       Location/Qualifiers
FT   CDS_pept        complement(349017..350351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0308"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   xau:Xaut_4843 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55352"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV9"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL55352.1"
FT                   /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLSA
FT                   ILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDVMAVTGLNRPDFR
FT                   TIAEFRKRHLAALSDLFVQVLRLCQAAGLVGFAHVAVDGTKLKANASRHKAMSYGRMKT
FT                   TEAALAAEVEAWLAQAAEMDAAEDRAHGMDRRGDETPDWMADKQRRLAAIRAAKAALEA
FT                   EAADPPAPEDESGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTEPDSRILPTRDGFVQG
FT                   YNGQIAVDAAHQVIVAQRLVTNAADYRALVPLIDDVSAHLGRKPREVSGDAGFATEANL
FT                   TALQARRIRGYLPPGRARHGEAHAAGRRKLTKMPLMSAMAQRLKRAGRRSRYRLRKQVV
FT                   EPVFGQMKQARGFRQFLLRGLEQVRGEWAMICTAHNLLKLAQAAR"
     atggccaagg tgtttcgctc ctgggatgtc gatcaaggct ggctgctgcc gccctcgttg        60
     catgagttcg tgccgcccgg gcatatggcg catttcgtgc gcgacacggt gcgcgaggcg       120
     ctcgatctgt cagccatcct cgacacctat accgaggagc gcggctatcc accctaccat       180
     cccggcatga tggtggcgct cctgctctac ggctacagcc gcggcctgta ctcctcgcgc       240
     caactcgccc gcgcctgcga ggagcgggtc gacgttatgg cggtgaccgg cctgaaccgg       300
     cccgacttcc gcaccatcgc cgagttccgc aagcgtcatc tcgcggcgct gtcggacctg       360
     ttcgtgcagg tgctgcggct gtgccaggcg gccgggctgg tgggctttgc tcatgtggcg       420
     gtggacggga ccaagctgaa ggccaatgcc tcgcgccaca aagcgatgag ctacggccgg       480
     atgaagacga ccgaagcggc cttggcggcc gaggtcgagg cgtggcttgc ccaagctgcc       540
     gagatggatg ccgctgagga ccgcgcgcac ggaatggatc ggcgcggcga cgagacgccg       600
     gactggatgg ccgacaagca gcggcggctt gctgcgatcc gcgccgccaa ggccgccctg       660
     gaagccgagg ccgccgatcc gcccgcccct gaggacgaga gcgggccggg cgcctcgtcg       720
     ggcatgcgtt ggcaggggcg gcccctgcgc ggcgaggacg gcggcccacc cgaccgggca       780
     cagcgcaact tcaccgagcc ggacagccgg atcctgccca cccgcgacgg gttcgtgcag       840
     ggctacaatg gccagatcgc ggtcgatgcg gcgcatcagg tgatcgtggc gcagcggctc       900
     gtgaccaacg cagccgacta tcgtgccctg gtgccgctga tcgacgacgt ctctgctcat       960
     ctcggacgca agccgcgcga ggtctcgggc gatgccggtt ttgccaccga ggcgaacctg      1020
     acggcgctcc aggcgcgtcg gatccggggc tacctgccgc ccggccgagc gcgtcacggc      1080
     gaggcccatg cggctggacg gcgcaagctg acgaagatgc cgctgatgag cgcgatggct      1140
     cagcggctga agcgggctgg gcgccggagc cgctaccgcc tgagaaagca ggtggtcgag      1200
     ccggtcttcg ggcagatgaa gcaggccaga ggttttcggc agttcctgct gcgcggtctt      1260
     gagcaggtcc gaggcgagtg ggcgatgatc tgcaccgccc ataacctcct gaagctggcg      1320
     caggccgcgc gctaa                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page