(data stored in ACNUC7421 zone)

EMBL: CP001349.PE301

CP001349.PE301       Location/Qualifiers
FT   CDS_pept        350731..352092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0309"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   met:M446_2297 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55353"
FT                   /db_xref="GOA:B8IAW0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW0"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACL55353.1"
FT                   /translation="MQPTAAPTAAAPTAPAAPHHPWYRVLYIQVLIAIALGVLLGYLAP
FT                   DTAKSMKPLGDAFIALIKMMIAPIIFCTIVHGIASIGDLKKVGRVGLKALVYFEAVSTL
FT                   ALLVGVIVGELIRPGAGFGADPAKLDASAVAGYAQKAAGESTIGHLMAIIPKSFFDALA
FT                   TGDLLQVLLIAILTGVVVTGLGERAKGVTHAIDVAAEIFFRIIGMIVKLAPLGAFGAMA
FT                   FTIGQFGIGKLGNLAGLVATFYLTSLFFVLVVLGLIARFAGFSILKFLAYIKDELLIVL
FT                   GTSSSESVLPHMMQKMKRLGASDSVVGLVIPTGYSFNLDGTNIYMTLATLFLAQAVGAD
FT                   LSFGQYATIILVAMLTSKGASGVTGAGFVTLAATLAAIPGNPVPVAAMALILGVDKFMS
FT                   ECRALTNLVGNGVATIVVSRWEGELDPVKLREVMAHPVAIGTEISDETPEPITP"
     atgcagccta ctgccgcccc aaccgccgcc gcgcccaccg cgcccgccgc gccgcatcac        60
     ccctggtaca gggttctcta catccaggtg ctgatcgcga tcgcgctcgg cgtgctgctc       120
     ggctatctgg ccccggacac cgccaagtcg atgaagccgc tcggcgatgc cttcatcgcg       180
     ctcatcaaga tgatgatcgc gcccatcatc ttctgcacca tcgtgcacgg catcgcgtcg       240
     atcggcgacc tgaagaaggt cggccgcgtg ggcctcaagg cgctggtgta tttcgaggcc       300
     gtgtcgaccc tcgcgctcct cgtcggggtg atcgtcggcg agctgatccg gccgggcgcc       360
     ggcttcgggg cggaccccgc caagctcgat gcgagtgcgg tggccggcta tgcccagaag       420
     gcagccggcg aatcgaccat cggccacctg atggcgatca tcccaaaaag cttcttcgac       480
     gccctcgcca ccggcgacct gctgcaggtg ctgctgatcg ccatcctcac cggcgtcgtg       540
     gtcacggggc tcggcgagcg cgccaagggc gtcacccacg cgatcgacgt cgcggccgag       600
     atttttttcc gcatcatcgg gatgatcgtg aagctcgcgc cgctcggcgc cttcggggcg       660
     atggccttca ccatcggcca gttcggcatc ggcaagctcg gcaatctcgc cggcctcgtc       720
     gccaccttct atctcacgag cctgttcttc gtgctggtgg tgctcggcct gatcgcgcgc       780
     ttcgcgggct tctcgatcct gaagttcctc gcctacatca aggatgagtt gctcatcgtg       840
     ctcggcacct cctcgtcgga gagcgtgctg ccgcacatga tgcagaagat gaagcggctc       900
     ggcgcatcgg actcggtggt cggcctcgtc atcccgaccg gctactcgtt caacctcgac       960
     ggcaccaaca tctacatgac gctggcgacg ctgttcctgg cacaggcggt cggcgcggat      1020
     ctgagcttcg gccaatacgc caccatcatc ctggtggcga tgctgacctc gaagggcgcc      1080
     tccggcgtca ccggcgccgg cttcgtgact ctcgccgcga ccctcgcggc gatcccgggc      1140
     aaccccgtcc cggtcgccgc gatggcgctc atcctcggcg tcgacaagtt catgtcggaa      1200
     tgccgcgcgc tcaccaacct ggtgggcaac ggcgtcgcca ccatcgtggt gagccgctgg      1260
     gagggcgagc tcgatccggt caagctgcgc gaggtgatgg cccacccggt ggcgatcggg      1320
     accgagatct cggacgagac gccggagccg atcacgcctt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page