(data stored in ACNUC7421 zone)

EMBL: CP001349.PE302

CP001349.PE302       Location/Qualifiers
FT   CDS_pept        352089..353012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0310"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: met:M446_2296 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55354"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW1"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACL55354.1"
FT                   /translation="MSTRPPLLIGLDVGGTKIAGIALGPDGRVLAERRAPTPRGDYEGS
FT                   LRAMTDLVAALEAAAGGTGTVGLGIPGAVSPATGLIKNANSTWLIGRPFKSDLEQRLGR
FT                   PVRIENDANCLAVSEAVDGAGAGASLVWAVILGTGVGSGIAVEARALSGRNRIAGEWGH
FT                   NPLPAPREDEHPGPPCYCGRRGCIEAWLSGPALTADHARVTGETLSGEAIVAAMRAGDA
FT                   VARATFARWRERLARSLASVINILDPDVIVLGGGLSTIDEVYPGLIEEAAPHVISDVVT
FT                   TPIVKSRYGDASGVRGAAWLWKDATD"
     ttgagcacgc gccctcccct cctgatcggc ctcgatgtcg gcggcaccaa gatcgccggc        60
     atcgcgcttg gcccggacgg ccgggtcctg gccgagcgcc gcgctcccac gccacggggc       120
     gattacgagg gatcgctgcg ggcaatgacc gatctcgtcg cggcgctgga agccgcggcc       180
     ggcggcaccg gcacggtcgg gctcggcatc ccgggcgcgg tctcgcccgc gaccggcctc       240
     atcaagaacg ccaattccac ctggctcatc ggccggccct tcaagtccga cctggagcag       300
     aggctcggcc gcccggtgcg gatcgagaac gacgccaatt gcctcgcggt ctctgaggcg       360
     gtcgacggcg ccggggcggg agcgagtctc gtctgggcgg tgatcctcgg caccggcgtc       420
     ggctcaggga tcgccgtcga ggcccgcgcg ctctccggcc gcaaccgcat cgccggggaa       480
     tggggccaca atcccctgcc cgctccgcgc gaggacgagc acccggggcc gccctgctat       540
     tgcggccgcc gcggctgcat tgaggcctgg ctctccggac cggcgctgac cgccgatcac       600
     gcccgggtca cgggcgagac cttaagcggc gaggcgatcg tcgcggcgat gcgggccggg       660
     gatgccgtcg cgcgggcgac cttcgcgcgc tggcgcgaac ggctcgcccg cagcctcgcc       720
     tcggtgatca atatcctcga tccggacgtg atcgtgctgg gcggcggcct ctcgaccatc       780
     gacgaggtct atccgggcct catcgaggag gcggccccgc atgtcatctc ggacgtggtg       840
     acgacgccca tcgtgaaaag ccgctacggc gacgcctccg gcgtgcgcgg agcggcttgg       900
     ctgtggaagg atgcgacgga ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page