(data stored in ACNUC7421 zone)

EMBL: CP001349.PE303

CP001349.PE303       Location/Qualifiers
FT   CDS_pept        complement(353037..353660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55355"
FT                   /db_xref="GOA:B8IAW2"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW2"
FT                   /inference="similar to AA sequence:KEGG:M446_2295"
FT                   /protein_id="ACL55355.1"
FT                   /translation="MSTGPSVPSAGTPPDRLTAMSAVLARNWWLVALRGVFAILFGIIA
FT                   LVSPIATLYTLVIFFAAYMLVDGIADIVAAVRAAERHERWGLLLAEGILDILVGIVAFL
FT                   VPGSALLAFVYLTAAWALVTGALMIAAAFRLHLDHGRWWLVLGGVCSVLFGIALLINPG
FT                   VSLLVLTYWLAGYAIAFGVLMLILAFRLRSRHAEALPPSAARPA"
     atgagcaccg gaccgtccgt tccttccgcc ggcacgccgc ccgaccggct gaccgccatg        60
     agcgccgtgc tcgcccgcaa ctggtggctg gtcgccctgc ggggcgtctt cgcgatcctg       120
     ttcgggatca tcgccctggt ctcgcccatc gcgacgctct acacgctggt gatcttcttc       180
     gccgcctaca tgctggtcga cgggatcgcc gacatcgtcg cggcggtgcg ggccgcggag       240
     cggcacgagc gctggggtct cctcctggcg gaggggattc tcgacatcct ggtcggcatc       300
     gtggccttcc tggtgccggg cagcgcgctc ctggccttcg tctatctcac ggcggcctgg       360
     gcgctggtca cgggcgcgct gatgatcgcg gcggccttcc ggctgcacct cgaccatggg       420
     cgctggtggc tggtgctcgg gggcgtctgc tcggtgctgt tcggcatcgc gctcttgatc       480
     aatcccggcg tatccctgct cgtgctcacc tactggctgg ccggctacgc catcgcgttc       540
     ggcgtcctga tgctgatcct cgccttccgc ctgcgcagcc ggcatgccga ggccctgccg       600
     ccaagcgccg cgcggccggc ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page