(data stored in ACNUC7421 zone)

EMBL: CP001349.PE304

CP001349.PE304       Location/Qualifiers
FT   CDS_pept        353875..355077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0312"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   mrd:Mrad2831_3613 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55356"
FT                   /db_xref="GOA:B8IAW3"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW3"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACL55356.1"
FT                   /translation="MLDDQSGAEHRDGRSPDAPAARNRADLPRSHDATPSPDREPERTG
FT                   SSRDGRGGRGEKTPSPIRRHPVWFALGAILLVATGAAGFWYWLVFVHPYESTDDAFVAA
FT                   RQFSVAPKVSGYVVAVPVTDNQHVEAGSVLFQIDRRDYAAALREAQAQVASAEAAIRNI
FT                   DAQIEAQRGSIAEAEAQVEQADAALAFARQEAARYQDLAQRGAGSIQQSQQSTSNLQQQ
FT                   QANLSRARAAVTVAQKQVGSLQAQRAGAEASLAQARAQEEQARLNLGYTTVTAAQAGRV
FT                   VRLTGAVGQYAQAGQALGMFVPDDIWITANFKETQITDMRPGQDVDVEIDAYPDRTIKG
FT                   RVESVQPGSGTAFSLLPAENATGNFVKVVQRVPVKIVVDHWPEDVAIGPGLSVVPTVRV
FT                   R"
     atgctggacg atcaatccgg cgcggagcac cgcgacgggc ggagtcccga tgcgccggcg        60
     gcgaggaacc gggccgacct gcctcgctcc cacgacgcga ccccctcccc ggaccgggag       120
     ccggagcgga cgggttcgtc ccgggacggc cgaggcggcc ggggcgagaa gacgccgtcg       180
     ccgatccgcc gccacccggt ctggttcgcc ctcggcgcga tcctgctcgt cgccacgggg       240
     gcggcgggct tctggtactg gctcgtcttc gtgcacccct acgagtccac ggacgacgcc       300
     ttcgtggccg cccgccagtt ctcggtcgcc ccgaaggtct cgggctacgt cgtggccgtg       360
     ccggtcaccg acaaccagca cgtcgaggcc ggcagcgtcc tgttccagat cgaccggcgc       420
     gactacgcgg ccgccctccg ggaggcgcag gcgcaggtcg cctcggccga ggccgcgatc       480
     cgcaacatcg acgcgcagat cgaggcccag aggggcagca tcgcggaggc cgaggcgcag       540
     gtcgagcagg ccgatgccgc cctcgccttc gcccgccagg aggctgcccg ctaccaggac       600
     ctcgcccagc gcggcgcggg cagcatccag caatcccagc aatcgacctc gaacctgcag       660
     cagcagcagg ccaacctgtc ccgcgcccgc gccgccgtga ccgtggcgca gaagcaggtc       720
     ggctcgctgc aggcccagcg ggccggcgcc gaggcgagcc tcgcccaggc gcgcgcccag       780
     gaggagcagg cgaggctcaa cctcggctat acgaccgtga cggcggccca ggccggccgg       840
     gtggtccgcc tcaccggagc ggtcggccaa tacgcgcagg ccggccaggc gctcggcatg       900
     ttcgtgcccg acgacatctg gatcaccgcg aacttcaagg aaacccagat caccgacatg       960
     cggccgggcc aggacgtcga tgtcgagatc gacgcctacc cggatcgcac gatcaagggc      1020
     cgcgtcgagt ccgtgcagcc gggctcggga accgctttca gcctgctccc ggccgagaac      1080
     gccacgggca acttcgtgaa ggtggtgcag cgcgtgccgg tgaagatcgt ggtcgaccac      1140
     tggccggagg acgtcgcgat cgggcccggc ctgtccgtcg tgccgacggt gcgggtgcgg      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page